Name: Recombinant Mouse Interleukin-18-binding protein (Il18bp)
Brand: CUSABIO
SKU: CSB-RP167694m

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Il18bp

Uniprot No.

Q9Z0M9

Research Area

Others

Alternative Names

Il18bp; Igifbp; Interleukin-18-binding protein; IL-18BP; Interferon gamma-inducing factor-binding protein

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

29-193aa

Target Protein Sequence

TSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKEVPLNGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRSTNFSCLFVDPGQVAQYHIILAQLWDGLKTAPSPSQETLSSHSPVSRSAGPGVA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

22.0kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

To produce recombinant Mouse Il18bp protein, a well-established recombinant DNA technology is the key. A DNA template of Il18bp was constructed with N-terminal 6xHis tag using the technique. Once the template was made, the recombinant Mouse Il18bp protein could be produced with it efficiently. CUSABIO has built a strict QC system to ensure quality. The expression region is 29-193aa of the Mouse Il18bp. The purity of this recombinant is 90% determined by SDS-PAGE.

Il18bp (Igifbp) is a protein coding gene that encodes Interleukin-18-binding protein. According to some studies, Il18bp may have the following features.
IL1R9 is evolutionarily related to IL18BP and may function as an IL-18 receptor. Plasma levels of IL18/IL18BP were elevated during the active stage of the disease, suggesting that it may play a role in the pathogenesis and process of ITP. Myocardial ischemia is a target of IL18BP, and the use of IL18BP may therefore reduce ischemia-induced myocardial dysfunction. All IL18BPs use a conserved inhibitory mechanism by blocking a putative receptor binding site on IL18, but the interface on IL18 can be altered by the broad and diverse family of mammalian and poxvirus IL18BPs.

Code	CSB-RP167694m
Abbreviation	Recombinant Mouse Il18bp protein
MSDS	MSDS Datasheet
Size	US$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Interleukin-18-binding protein (Il18bp)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage