Recombinant Mouse Interleukin-18-binding protein(Il18bp)

Code CSB-RP167694m
Size US$2466
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

The Latest Promotion
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names Il18bp
Uniprot No. Q9Z0M9
Research Area Others
Alternative Names Il18bp; Igifbp; Interleukin-18-binding protein; IL-18BP; Interferon gamma-inducing factor-binding protein
Species Mus musculus (Mouse)
Source E.coli
Expression Region 29-193aa
Target Protein Sequence TSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKEVPLNGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRSTNFSCLFVDPGQVAQYHIILAQLWDGLKTAPSPSQETLSSHSPVSRSAGPGVA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 22.0kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Binds to IL-18 and inhibits its activity. Functions as an inhibitor of the early TH1 cytokine response (By similarity).
Gene References into Functions
  1. IL-18BP ameliorates cardiac ischemia/reperfusion injury in part through suppression of Th17 differentiation. PMID: 26340315
  2. Data show that IL-18bp acts as a sensor for IFN-gamma and can regulate both Th1 and Th17 responses in the CNS. PMID: 20644165
  3. Administratioan of murine IL-18BP at the time of the booster injection of bovine CII reduces the progressive severity of collagen-induced arthritis; both clinical disease activity and histological scores are decreased by 50%. PMID: 12574381
  4. functional polarization of Ag-specific CD4(+) Th2 cells entering the CNS during the accelerating phase of experimental autoimmune encephalomyelitis is flexible and dependent on IL-18, which is overturned by IL-18 binding protein PMID: 15778395
  5. IL-18 and IL-18BP may have roles in testicular development, and also in the regulation of testicular functions under physiological conditions PMID: 18299271
  6. A single intravenous dose of recombinant mouse IL18BP decreased neointimal hyperplasia and improved arterial L/A ratios in an atherosclerotic balloon-injury animal model. PMID: 18455646

Show More

Hide All

Subcellular Location Secreted
Database Links

KEGG: mmu:16068

STRING: 10090.ENSMUSP00000091685

UniGene: Mm.422756

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1