Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
Il18bp; Igifbp; Interleukin-18-binding protein; IL-18BP; Interferon gamma-inducing factor-binding protein
Species
Mus musculus (Mouse)
Expression Region
29-193aa
Target Protein Sequence
TSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKEVPLNGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRSTNFSCLFVDPGQVAQYHIILAQLWDGLKTAPSPSQETLSSHSPVSRSAGPGVA
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
To produce recombinant Mouse Il18bp protein, a well-established recombinant DNA technology is the key. A DNA template of Il18bp was constructed with N-terminal 6xHis tag using the technique. Once the template was made, the recombinant Mouse Il18bp protein could be produced with it efficiently. CUSABIO has built a strict QC system to ensure quality. The expression region is 29-193aa of the Mouse Il18bp. The purity of this recombinant is 90% determined by SDS-PAGE.
Il18bp (Igifbp) is a protein coding gene that encodes Interleukin-18-binding protein. According to some studies, Il18bp may have the following features.
IL1R9 is evolutionarily related to IL18BP and may function as an IL-18 receptor. Plasma levels of IL18/IL18BP were elevated during the active stage of the disease, suggesting that it may play a role in the pathogenesis and process of ITP. Myocardial ischemia is a target of IL18BP, and the use of IL18BP may therefore reduce ischemia-induced myocardial dysfunction. All IL18BPs use a conserved inhibitory mechanism by blocking a putative receptor binding site on IL18, but the interface on IL18 can be altered by the broad and diverse family of mammalian and poxvirus IL18BPs.
