Recombinant Mouse Lymphocyte antigen 6A-2/6E-1 (Ly6a)

In Stock Promotion
Code CSB-EP356543MO
Abbreviation Recombinant Mouse Ly6a protein
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Ly6a
Uniprot No.
Research Area
Cardiovascular
Alternative Names
Ly-6A.2/Ly-6E.1;Stem cell antigen 1;SCA-1;T-cell-activating protein;TAP
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
27-112aa
Target Protein Sequence
LECYQCYGVPFETSCPSITCPYPDGVCVTQEAAVIVDSQTRKVKNNLCLPICPPNIESMEILGTKVNVKTSCCQEDLCNVAVPNGG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
16.7 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Mouse Ly6a protein expression involves transfecting e.coli cells with a DNA expression vector containing the gene encoding the recombinant protein of interest (27-112aa) and then culturing the cells so that they express the desired protein. The protein features a N-terminal 10xHis tag and C-terminal Myc tag fusion. The recombinant Mouse Ly6a protein is collected and purified from the cell lysate through affinity purification. Its purity is greater than 90%, as measured by SDS-PAGE.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
T-cell activation.
Gene References into Functions
  1. In early stages, overexpression of Sca-1 decreases tumour formation while at later stages overexpression of Sca-1 seems to drive tumours towards malignant progression. PMID: 28732240
  2. Sca-1 is a novel cancer stem cells enrichment marker. PMID: 26869189
  3. IL-27-induced Sca-1(+) T cells had increased expression of effector/memory-associated transcription factor T-bet, Eomes and Blimp1. PMID: 28758191
  4. SCA-1 enriches for an ERalpha(+), estrogen-sensitive subpopulation within the CD24(+)/CD49f(hi) MaSC population that may be responsible for the hormonal sensitivity of the developing mammary gland. PMID: 28132885
  5. Upregulation of leptin levels in both the vessel wall and the circulation after vessel injury promoted the migration of Sca-1(+) progenitor cells via leptin receptor-dependent signal transducer and activator of transcription 3- Rac1/Cdc42-ERK (extracellular signal-regulated kinase)-FAK pathways, which enhanced neointimal formation. PMID: 28935755
  6. Both the number of lung CD31-CD45-Sca-1+ cells and the expression levels of the Shh signaling pathway were downregulated in the lung tissues of mice with pulmonary emphysema. These cells and Shh signaling pathway are reactivated during acute adenovirus infection. PMID: 28352167
  7. we report significantly higher expression of the immunoglobulin light chain by B cells in lamina propria of Ly-6A/Sca-1deficient mice when compared to the wild-type control. PMID: 27322740
  8. c-Myb regulates proliferation/differentiation of adventitial Sca1+ vascular smooth muscle progenitor cells by transcriptional activation of myocardin. PMID: 27174098
  9. sca-1 antibody reduces both CD34+/c-kit+ progenitor cell surge and vascular restenosis after endoluminal vascular injury in a murine model. PMID: 27666446
  10. Results indicate that IL-17A promotes tumorigenicity of colon cancer cells by enhancing cell cycle progression and directly induces the expression of Sca-1. PMID: 27378226
  11. Study provides evidence that up-regulation of miRNA-21 can promote migration and proliferation of Sca-1+ CSCs to enhance the capacity of Sca-1+ CSCs to repair damaged myocardium. PMID: 27210794
  12. the androgen-independent and bipotent organoid-forming Sca-1(+) luminal cells as a functionally distinct cellular entity, is reported. PMID: 26418304
  13. Sphingosylphosphorylcholine promotes the differentiation of resident Sca-1 positive cardiac stem cells to cardiomyocytes through lipid raft/JNK/STAT3 and beta-catenin signaling pathways. PMID: 27066979
  14. Data show that bisperoxovanadium (BpV) treatment induces specific epigenetic modifications at the promoter regions of genes associated with stem cell fate, including Sca-1 and Pw1. PMID: 26672000
  15. The results suggested that the depletion of the progenitor cell pool and DNA methylation of Sca-1 gene may be involved in the progression of emphysema in mice. PMID: 26264445
  16. PDGFRalpha has a role in demarcating the cardiogenic clonogenic Sca1+ stem/progenitor cell in adult murine myocardium PMID: 25980517
  17. The progenitor phenotype of the Sp-C(+)Sca-1(+) cells that mediates alveolar epithelial repair might involve Wnt signaling. PMID: 25474582
  18. Subcutaneous and visceral fat-derived Sca1(high) ASCs particularly differ in the gene expressions of adhesion and ECM molecules. PMID: 24726953
  19. The more aggressive behavior of Ly6a/Sca-1 expressing leukemias is due at least in part to greater capacity to degrade microenvironmental stroma and invade tissues. PMID: 24586463
  20. Reversal of ischemic cardiomyopathy with Sca-1+ stem cells modified with multiple growth factors. PMID: 24705272
  21. Sca1 and bromodeoxyuridine positive cells may participate in the formation of new thyroid follicles after partial thyroidectomy. PMID: 24278321
  22. Sca1 positive murine pituitary adenoma cells show tumor-growth advantage. PMID: 24481638
  23. The high and specific expression of stem cell antigen 1 (Sca1) in TtT/GF cells was confirmed by real-time polymerase chain reaction. PMID: 23881407
  24. Application of hematopoietic progenitor (lin-/sca-1+) or endothelial progenitor cells potentially improves the inflammatory and oxidative stress parameters in an atherosclerosis model. PMID: 22622053
  25. the A2B receptor signaling linked to up-regulation of pro-angiogenic factors in cardiac Sca-1(+)CD31(-) stromal cells is essential for overall improvement of cardiac recovery seen after their transplantation to the injured heart. PMID: 23827818
  26. Report the distribution of c-kit/Sca-1/CXCR4 expressing cardiac stem cells in the different compartments of the heart and significant reduction in their number in adult heart. PMID: 23273785
  27. Sca-1(-) Plasmacytoid dendritic cells are an early developmental stage of Plasmacytoid dendritic cells with distinct innate functions representing the true murine natural IFN-alpha-producing cells. PMID: 23922217
  28. These results demonstrate that TLR4/Sca-1 signaling plays an important role in the regulation of hematopoietic precursor cell programming and their enhancement of granulocyte lineage commitment in response to E. coli bacteremia. PMID: 23545304
  29. PECAM1(+)/Sca1(+)/CD38(+) vascular cells could proliferate and differentiate into myofibroblast-like cells in wound repair. PMID: 23308177
  30. Sca-1(+) cells expressed markedly higher levels of mammary stem cell-related genes in comparison to Sca-1(-) cells. PMID: 22634533
  31. Identification of a population of LY6A+ mouse ovarian surface epithelium progenitor cells on the surface of the ovary that may play a role in ovulatory wound healing. PMID: 22914315
  32. results of this study suggest that increased Sca1 expression on erythropoietic precursors inhibits erythroid differentiation PMID: 23246681
  33. Sca-1 protects against cardiac hypertrophy and fibrosis via regulation of multiple pathways in cardiomyocytes. PMID: 22851736
  34. Data show that deletion of Sca-1 causes primary cardiac defects in myocardial contractility and repair consistent with impairment of resident cardiac progenitor cell proliferative capacity. PMID: 22800687
  35. Sca-1 is either redundant or a nonessential marker of adipose progenitor/stem cells. PMID: 21510817
  36. Studies suggest that the cloned Sca-1+CD45- cells confer the therapeutic benefits of Cardiospheres (CSs) in the mouse myocardial infarction (MI) model. PMID: 22272337
  37. Sca-1 is a negative regulator of the tumor suppressor effects of PPARgamma PMID: 21955520
  38. enhanced Sca-1 expression facilitates activation of the ERK pathway and supports the proliferation of myeloid and granulopoietic precursors during bacteremia; alcohol intoxication suppresses this response PMID: 22238460
  39. MicroRNA-126 modulates endothelial SDF-1 expression and mobilization of Sca-1(+)/Lin(-) progenitor cells in ischaemia. PMID: 21856785
  40. These data demonstrate the crucial role of Sca-1 in the maintenance of cardiac integrity and suggest that Sca-1 restrains spontaneous differentiation in the precursor population. PMID: 21957128
  41. Results imply that Sca-1-positive cells may have a role in the duct cell proliferation in the regeneration step elicited by excretory duct ligation-induced injury. PMID: 21884259
  42. Postulate that SCA1(+)/CD31(+) cardiac side population cells may represent endothelial progenitor cells in the mouse heart. PMID: 21615679
  43. Hematopoietic lineage cells with Sca-1(high) expression and CD62L(neg/low) expression are characterized as multipotent progenitor cells, based on transient engraftment. PMID: 21998453
  44. Ly6a as a candidate gene for functional involvement in novelty responsiveness PMID: 21673958
  45. Inhalation of acrolein increases apoptosis and suppresses the circulating levels of Flk-1(+)/Sca-1(+) cells while increasing these cells in the bone marrow and preventing their mobilization by VEGF. PMID: 21527748
  46. Sca-1 attenuated GDF10-dependent TGF-beta signaling by disrupting the heterodimerization of TbetaRI and TbetaRII receptors. PMID: 21518866
  47. TGF-beta1 represses Sca-1 expression in T cells and other immune cell populations derived from the spleen, indicating that regulation by TGF-beta1 is a general feature of Sca-1 expression in multiple cell types PMID: 21156809
  48. Sca-1-/- mice have a defect in their capacity to recruit soluble IgM, and subsequently C3 complement, to damaged muscle. There was a significant reduction in B-1a cells in Sca-1-/- mice. PMID: 21123737
  49. Prior exposure of mesenchymal stem cells to hypoxia led to a significant reduction of ex vivo expansion time, with significantly increased numbers of Sca-1(+) as well as Sca-1(+)/CD44(+)double-positive cells. PMID: 20496083
  50. Ly-6C(hi) monocytosis disturbs resolution of inflammation in murine infarcts and consequently enhances left ventricular remodeling. PMID: 20378083

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Tissue Specificity
Widely expressed.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*