Recombinant Mouse Metallothionein-3 (Mt3)

In Stock
Code CSB-EP015122MO
Abbreviation Recombinant Mouse Mt3 protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Mt3
Uniprot No.
Research Area
Neuroscience
Alternative Names
Growth inhibitory factor Short name: GIF
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-68aa
Target Protein Sequence
MDPETCPCPTGGSCTCSDKCKCKGCKCTNCKKSCCSCCPAGCEKCAKDCVCKGEEGAKAEAEKCSCCQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
14.5 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds heavy metals. Contains three zinc and three copper atoms per polypeptide chain and only a negligible amount of cadmium. Inhibits survival and neurite formation of cortical neurons in vitro.
Gene References into Functions
  1. the absence of Mt3 reduces Abeta uptake in astrocytes through an abnormality in actin polymerization. PMID: 26637294
  2. Circadian time and lighting could be involved in the regulation of the expression of melatonin receptors MTNR3 and Rorc. PMID: 25189895
  3. Mt3 may act through PDE3a to play a key role in Zinc dyshomeostasis and cell death in streptozotocin-treated islets. PMID: 25054451
  4. Zn released from MT3 may contribute to VEGF induction. PMID: 23962989
  5. The entire MT3 peptide shows a high capacity to bind Cu(+) , provided that this occurs in a nonoxidative milieux. This reflects a peculiar property of this MT isoform, which senses different Cu contents in the environment in which it is synthesized. PMID: 24479872
  6. MT-III can help protect against light-induced retinal damage compared to MT-I/II. Some of these effects may be exerted by its antioxidative potency. PMID: 23132798
  7. MT-3 is able to alter the Tg2576 phenotype in several aspects such as mortality and behavior in a gender-dependent manner. PMID: 22722772
  8. ZnMt3 in cultured astrocytes may be a normal component of c-Abl activation in EGF receptor signaling PMID: 21900236
  9. Metallothionein-III null mice show attenuation of cadmium-induced severe testicular toxicity, suggesting that lack of MT-III contributes to protection of testis from cadmium. PMID: 20851133
  10. results indicate that MT3 may play a key role in normal lysosomal function in cultured astrocytes PMID: 20544854
  11. findings indicate that abnormalities of psychological behavior were observed in the MT-3 knock-out mice PMID: 19799968
  12. engineered protein has neuroinhibitory activity when introduced into metallothionein-1 PMID: 12130647
  13. a correct MTs homeostasis is pivotal for brain-endocrine-immune response in order to reach successful ageing. PMID: 12714242
  14. Metallothionein 3 [Mt3]-null mice had increased expression of neurotrophins as well as GAP-43 following cryoinjury. Thus MT-III does not affect the inflammatory response, but it may influence neuronal regeneration during recovery PMID: 12758064
  15. MT-III isoform, which has a limited tissue distribution, especially in the central nervous system, seems to be implicated in tissue repair and/or protection against critical tissue injury PMID: 17435258
  16. These findings indicate that neuronal damage was aggravated by reperfusion injury in the MT-III KO mice compared with the wild-type mice, suggesting that MT-III plays anti-oxidative and neuroprotective roles in transient cerebral ischemia. PMID: 19635467

Show More

Hide All

Protein Families
Metallothionein superfamily, Type 1 family
Tissue Specificity
Brain.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*