Recombinant Mouse Myelin basic protein (Mbp)

In Stock
Code CSB-YP013551MO
Abbreviation Recombinant Mouse Mbp protein
MSDS
Size $306
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
1-250aa
Target Protein Sequence
MGNHSGKRELSAEKASKDGEIHRGEAGKKRSVGKLSQTASEDSDVFGEADAIQNNGTSAEDTAVTDSKHTADPKNNWQGAHPADPGNRPHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDPTAASGGLDVMASQKRPSQRSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFSGDRGAPKRGSGKDSHTRTTHYGSLPQKSQHGRTQDENPVVHFFKNIVTPRTPPPSQGKGGRDSRSGSPMARR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
29.2 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The classic group of MBP isoforms (isoform 4-isoform 13) are with PLP the most abundant protein components of the myelin membrane in the CNS. They have a role in both its formation and stabilization. The non-classic group of MBP isoforms (isoform 1-isoform 3/Golli-MBPs) may preferentially have a role in the early developing brain long before myelination, maybe as components of transcriptional complexes, and may also be involved in signaling pathways in T-cells and neural cells. Differential splicing events combined to optional post-translational modifications give a wide spectrum of isomers, with each of them potentially having a specialized function.
Gene References into Functions
  1. findings suggest that the acetylation and methylation of lysine on MBP are post-translational modifications associated with the neurological disability produced by EAE. PMID: 29111742
  2. golli-KO mice display abnormal behavior including deficits in episodic memory and reduced anxiety. PMID: 26497031
  3. The Mbp(+/-) mice exhibited defects of sensorimotor gating, as evidenced by reduced prepulse-inhibition, and a late-onset catatonia phenotype. PMID: 27470661
  4. myelin basic protein (MBP) is inhibitory to both primitive neural stem cells and definitive neural stem cells derived colony formation. PMID: 27573615
  5. CNP directly associates with and organizes the actin cytoskeleton, thereby providing an intracellular strut that counteracts membrane compaction by myelin basic protein (MBP). PMID: 28076777
  6. to further characterize the mechanism regulating mbp transcription, study defined M3 structure/function relationships; multiple M3 regulatory element combinations were found to drive expression in oligodendrocytes and Schwann cells with a minimal 129 bp sequence conferring expression in oligodendrocytes throughout myelin elaboration, maintenance and repair PMID: 26507463
  7. Results show the expression of sncRNA715 in Schwann cells and its inverse correlation with Mbp mRNA in cultured cells and the sciatic nerve. Its inhibitory effect on MBP was confirmed in differentiating primary Schwann cells. PMID: 26317513
  8. Results suggest that GAL is a regulator of myelination, as demonstrated by MBP synthesis, and may be one of the myelination promoters PMID: 25450959
  9. Data indicate that 18.5 kDa myelin basic protein (MBP) segment upstream of the primary SH3-ligand is involved in interaction. PMID: 25343306
  10. Data suggest that prenatal alterations in expression of various fetal brain proteins (including up-regulation of Mbp) are associated with aberrant behavioral characteristics of transgenic mice that model autism-like behavior. PMID: 25849768
  11. Data suggest that hybrid protein composed of two different Myelin basic protein (MBP) isoforms (TandeMBP) might become a tool for in vitro assays to analyse various protein kinase activities. PMID: 24713852
  12. Data indicate a role for myelin basic protein (MBP) isoforms in protein-protein interactions during membrane and cytoskeletal extension and remodeling in oligodendrocytes (OLGs). PMID: 24956930
  13. Disappearance of 21.5 pMBP corresponded to demyelination and its reappearance corresponded to prevention of demyelination. PMID: 24459152
  14. Golli-BG21 enhanced SCP1/GIP phosphatase activity, whereas PKCalpha-phosphorylated BG21 inhibited its activity, suggesting a potential role of BG21 as a molecular switch ("quick-brake mechanism") on SCP1/GIP. PMID: 24751520
  15. MBP expression in cultured Fmr1 KO oligodendrocytes is similar to wild type, and expression of MBP in brain homogenates of the Fmr1 KO mouse to be similar to wild type. PMID: 23891804
  16. myelin basic protein drives myelin biogenesis using weak forces arising from its inherent capacity to phase separate. PMID: 23762018
  17. Myelin basic protein-21.5 kDa in the nucleus promotes oligodendrocyte proliferation, while melin basic protein-18.5-kDa in plasma membrane does not. PMID: 23184356
  18. 21.5-kDa MBP contains two non-traditional PY-nuclear-localization signals, and arginine and lysine residues within these motifs were involved in subcellular trafficking of this protein to the nucleus, where it may have functional roles during myelinogenesis. PMID: 22609403
  19. Loss of MBP is associated with aging and hearing loss. PMID: 22496821
  20. Myelin basic protein (MBP) performs distinct actions on the formation, maturation, degeneration and regeneration of sciatic nerve myelin sheath. PMID: 21824506
  21. Regulation of the Mbp gene, along with the relative amount of expressed Mbp protein, suggests that the immortalized cell lines containing them are representative of immature oligodendrocytes. PMID: 21472765
  22. The results of this study suggested that MBP's SH3 ligand domain plays a key role in intracellular protein interactions in vivo and may be required for proper membrane elaboration of developing oligodendrocytes. PMID: 21887699
  23. Molecular dynamics simulations were conducted to investigate the conformation of the immunodominant epitope of acetylated myelin basic protein residues 1-11 and its altered peptide ligands, mutated at position 4 to an alanine or a tyrosine residue. PMID: 22042377
  24. define hnRNP F as a regulatory element of MBP expression in oligodendrocytes and imply an important function of hnRNP F in the control of myelin synthesis. PMID: 22128153
  25. there is an N-terminal binding domain in MBP for Ca(2+)-CaM PMID: 21889463
  26. Human umbilical cord blood-derived mesenchymal stem cells upregulate myelin basic protein in shiverer mice. PMID: 20925478
  27. our data indicate a key role for golli proteins in the regulation of TRPC-mediated Ca(2+) influx PMID: 21389218
  28. The density of high-voltage-activated currents is reduced in oligodendroglial precursor cells recorded in golli-deficient tissue, while low-voltage-activated currents remain unaltered in these cells. PMID: 20607717
  29. The QKI-6 RNA binding protein localizes with the MBP mRNAs in stress granules of glial cells. PMID: 20862255
  30. These results are the first to provide atomic-level detail of a membrane-anchoring segment of MBP. PMID: 20713009
  31. Secondary structure and solvent accessibility of a calmodulin-binding C-terminal segment of membrane-associated myelin basic protein. PMID: 20831157
  32. When MBP was reconstituted with myelin-mimetic membranes, there was a rearrangement of secondary structure components upon addition of zinc. PMID: 20169373
  33. results provide a detailed picture of the MBP-CaM interaction, including a 3D model of the complex between full-length proteins PMID: 19855925
  34. the divalent cations copper and zinc induce a compaction of the extended myelin basic protein in vitro, suggestive of a tertiary conformation that may reflect its arrangement in myelin. PMID: 19903451
  35. helical tubular vesicles were formed by binary monolayers containing a nickel-chelating lipid and phosphoinositides in the presence of myelin basic protein PMID: 11841829
  36. Myelin basic protein has a role in contact-mediated expression of inducible Nitric Oxide Synthase in microglial cells PMID: 12176974
  37. calmodulin-binding properties of N- and C-terminal deletion mutants of MBP PMID: 12901870
  38. MBP has an alpha-helix tilted 9 degrees, and the central lysine is positioned for side-chain interaction with the negatively charged phospholipid head groups PMID: 14630913
  39. role in expression of insulin-like growth factor 1 PMID: 15139287
  40. electron paramagnetic resonance of MBP-CaM interactions PMID: 15522783
  41. An enhancer 9.0 kb upstream of Mbp (MbpSCE1) activates Mpz specifically in Schwann cells in transgenic mice. MbpSCE1 is active in both Schwann cells and oligodendrocytes, but by diverse mechanisms. PMID: 15525335
  42. Fyn plays critical roles in promoting accelerated MBP expression during myelinogenesis in a MBP isoform-preferential manner, and QKI may act in the same pathway downstream of Fyn for MBP mRNA homeostasis PMID: 15528192
  43. Taken together, these results demonstrate that microglia and/or microglia secreted factors, are necessary for the LPS-promoted proliferation of OPCs and suggest possible involvement of Golli proteins as one of mediators in this process. PMID: 15546149
  44. Deimination of MBP, a posttranslational modification which occurs early in life, attenuates the ability of MBP to polymerize and bundle actin, and to bind it to a negatively charged membrane. PMID: 15736962
  45. microglial activation of C/EBPbeta but not NF-kappaB by T cell:microglial contact is a gender-specific event, resulting in the inability of male MBP-primed T cells to induce microglial expression of proinflammatory molecules PMID: 16046404
  46. role for golli proteins in oligodendrocyte differentiation, migration, and/or myelin elaboration in the brain PMID: 16049176
  47. Transient transfections with a luciferase reporter gene driven by the myelin basic protein promoter define how changes in the molecular composition of these transcriptional complexes modulate myelin gene expression. PMID: 16148239
  48. discovered epitope-specific antibody-mediated degradation of MBP suggests a mechanistic explanation of the slow development of neurodegeneration associated with multiple sclerosis PMID: 16387849
  49. These results demonstrate that both STOP and MBP function as microtubule-stabilizing proteins in differentiating oligodendrocytes and could be important for the PMID: 16773649
  50. Golli-deficient T cells were hyperproliferative and showed enhanced calcium entry upon T cell receptor stimulation. PMID: 16782028

Show More

Hide All

Involvement in disease
Defects in Mbp are a cause of dysmyelinating diseases such as the shiverer (SHI) and myelin deficient (MLD) diseases characterized by decreased myelination in the CNS, tremors, and convulsions of progressively increasing severity leading to early death. The shiverer mice only express isoform 2, the MLD mice have a reduced amount of Mbp.
Subcellular Location
[Isoform 13]: Myelin membrane; Peripheral membrane protein; Cytoplasmic side.; [Isoform 12]: Myelin membrane; Peripheral membrane protein; Cytoplasmic side.; [Isoform 11]: Myelin membrane; Peripheral membrane protein; Cytoplasmic side.; [Isoform 10]: Myelin membrane; Peripheral membrane protein; Cytoplasmic side.; [Isoform 9]: Myelin membrane; Peripheral membrane protein; Cytoplasmic side.; [Isoform 8]: Myelin membrane; Peripheral membrane protein; Cytoplasmic side.; [Isoform 7]: Myelin membrane; Peripheral membrane protein; Cytoplasmic side.; [Isoform 6]: Myelin membrane; Peripheral membrane protein; Cytoplasmic side.; [Isoform 5]: Myelin membrane; Peripheral membrane protein; Cytoplasmic side.; [Isoform 4]: Myelin membrane; Peripheral membrane protein; Cytoplasmic side.; [Isoform 3]: Cytoplasm. Nucleus.; [Isoform 2]: Cytoplasm. Nucleus.; [Isoform 1]: Cytoplasm. Nucleus.
Protein Families
Myelin basic protein family
Tissue Specificity
In the embryo, isoform 1-isoform 3 are found in neurons within the central nervous system (primarily in pioneer neurons important in the formation of the cortex) and the peripheral nervous system. They are also expressed in the thymus, gut, lung and kidne
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*