Recombinant Mouse Nucleolin (Ncl), partial

Code CSB-YP015535MO
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP015535MO
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP015535MO-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP015535MO
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP015535MO
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
Ncl; NucNucleolin; Protein C23
Species
Mus musculus (Mouse)
Expression Region
301-646aa
Target Protein Sequence
EGSEPTTPFNLFIGNLNPNKSVNELKFAISELFAKNDLAVVDVRTGTNRKFGYVDFESAEDLEKALELTGLKVFGNEIKLEKPKGRDSKKVRAARTLLAKNLSFNITEDELKEVFEDAMEIRLVSQDGKSKGIAYIEFKSEADAEKNLEEKQGAEIDGRSVSLYYTGEKGQRQERTGKTSTWSGESKTLVLSNLSYSATKETLEEVFEKATFIKVPQNPHGKPKGYAFIEFASFEDAKEALNSCNKMEIEGRTIRLELQGSNSRSQPSKTLFVKGLSEDTTEETLKESFEGSVRARIVTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKG
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Nucleolin is the major nucleolar protein of growing eukaryotic cells. It is found associated with intranucleolar chromatin and pre-ribosomal particles. It induces chromatin decondensation by binding to histone H1. It is thought to play a role in pre-rRNA transcription and ribosome assembly. May play a role in the process of transcriptional elongation. Binds RNA oligonucleotides with 5'-UUAGGG-3' repeats more tightly than the telomeric single-stranded DNA 5'-TTAGGG-3' repeats.
Gene References into Functions
  1. The results demonstrated prolific RSV infection of N2a cells, which triggered a decrease of NeuN protein expression, coinciding with an increase of nuclear lesions, F protein expression, RSV viral titers, and late apoptotic levels of N2a cells. RSV infection induced co-localization of RSV F protein with TLR4 and nucleolin. PMID: 29427996
  2. The study demonstrated existence of a regulatory axis of miR-34b/nucleolin during muscle differentiation. PMID: 28422320
  3. Mitochondrial catalase induces neoplastic cell transformation through nucleolin-dependent Cox-2 mRNA stabilization. PMID: 29097213
  4. subcellular sequestration of nucleolin or importin beta1 enhances axonal growth and causes a subcellular shift in protein synthesis PMID: 27477284
  5. Data indicate alpha-P85 Subunit, PI-3K (p85alpha) as a positive regulator of epidermal growth factor receptor (EGFR) expression and cell malignant transformation via nucleolin-dependent mechanism. PMID: 26918608
  6. nucleolin inhibition is a new anti-pancreatic cancer therapeutic strategy that dually blocks tumor progression and normalizes tumor vasculature in pancreatic ductal adenocarcinoma PMID: 27754848
  7. Nucleolin protects macrophages from oxLDL-induced foam cell formation in hyperlipidemia through up-regulating ABCA1 expression. PMID: 28315324
  8. Nucleolin Acts as a Scavenger Receptor for Acetylated Low-Density Lipoprotein on Macrophages PMID: 26328500
  9. Nucleolin is a receptor for maleylated-bovine serum albumin on macrophages PMID: 25744467
  10. Lrrc34, a novel nucleolar protein, interacts with npm1 and ncl and has an impact on pluripotent stem cells PMID: 24991885
  11. results indicate that nucleolin is a receptor that allows macrophages to recognize toxic Advanced glycosylation end-products. PMID: 24818254
  12. results for the first time demonstrate that nucleolin-SUMO at K294R plays a critical role in its nucleus sequestration and gadd45alpha mRNA binding activity. PMID: 25561743
  13. Nucleolin-FGF1 interaction is critical for the intranuclear phosphorylation of FGF1 by PKCdelta and thereby the regulation of nuclear export of FGF1. PMID: 24595027
  14. Suggest that during heart disease nucleolin is reactivated to mobilize conserved aspects of chromatin remodeling and gene expression. PMID: 24077883
  15. Nucleolin is involved in the regulation of ischemia reperfusion-induced cardiac injury and dysfunction via the regulation of Hsp32. PMID: 23594402
  16. Data demonstrate that nucleolin is a critical regulator of ESC self-renewal and that suppression of the p53-dependent pathway is the major molecular mechanism underlying functions of nucleolin in ESCs. PMID: 22013067
  17. nucleolin is constantly induced in tumor cells to mediate calcium-dependent ligand internalization PMID: 21203423
  18. Nucleolin is clearly involved in the carcinogenic process of H. pylori as a major cellular receptor of Tip-alpha protein that shuttles Tip-alpha from cell surface to cytosol and nuclei. PMID: 20049476
  19. nucleolin is one of several acharan sulfate (AS)-binding proteins, and suggest that AS might demonstrate its tumor growth inhibitory activity by binding the nucleolin receptor protein on the surface of cancer cells PMID: 15329357
  20. These findings demonstrate the importance of increased translation of p53 in DNA-damage responses and suggest critical roles for RPL26 and nucleolin in affecting p53 induction. PMID: 16213212
  21. nucleolin could be involved in the early stage of tooth germ initiation and morphogenesis, possibly by regulating the midkine expression PMID: 17562718
  22. analyzed 4.5S RNAh-binding proteins(nucleolin) in mouse nuclear extracts using gel mobility shift and RNA-protein UV cross-linking assays. PMID: 17971306

Show More

Hide All

Subcellular Location
Nucleus, nucleolus. Cytoplasm.
Tissue Specificity
Expressed in B-cells that have been induced to switch to various Ig isotypes.
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1