Recombinant Mouse Peptide YY (Pyy), partial

In Stock
Code CSB-EP019128MO
Abbreviation Recombinant Mouse Pyy protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
(PYY)(Peptide tyrosine tyrosine)(3-36)(PYY-II)
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
29-64aa
Target Protein Sequence
YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.2 kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This gut peptide inhibits exocrine pancreatic secretion, has a vasoconstrictory action and inhibitis jejunal and colonic mobility.
Gene References into Functions
  1. Data show that peptide YY (PYY) mRNA levels were ~ 40,000-fold higher in mouse than human islets, suggesting a more important role of locally secreted Pyy in mouse islets. PMID: 29455414
  2. These results indicate that endogenous PYY has a hypoalgesic effect on somatic thermal and visceral chemical pain. The effect on visceral pain seems to be mediated by peripheral Y2 receptors. PMID: 28106168
  3. Study suggests that PYY3-36 mediated signalling via Y5 receptors may counteract the anorectic effects that it mediates via the Y2 receptor, consequently lowering bodyweight in the absence of Y5 signalling. PMID: 28485050
  4. expression of PYY and its NPY receptors on mouse islets and immortalised rodent and human beta-cells was examined. PMID: 27465830
  5. Angiotensin II stimulates PYY secretion, in turn inhibiting epithelial anion fluxes, thereby reducing net fluid secretion into the colonic lumen. PMID: 27447725
  6. new information on the cell specific localization of NUCB2/nesfatin-1 in the intestinal mucosa, and a novel function for nesfatin-1 in modulating intestinal CCK and PYY expression and secretion PMID: 26920055
  7. Data (including data from studies in transgenic mice) suggest neurotensin (Nts), glucagon-like peptide I (GLP-1), and peptide YY (Pyy) are closely co-expressed and co-secreted within enteroendocrine cells in ileum mucosa. PMID: 26469136
  8. pancreatic islet-derived PYY plays an important role in controlling glucose homeostasis through the modulation of beta-cell mass and function PMID: 26125465
  9. The patterns of colocalisation of the K cell marker, glucagon-like insulinotropic peptide, and the L cell markers, glucagon like peptide-1 and peptide YY, in enteroendocrine cells of the small intestine and colon of mouse and pig, were investigated. PMID: 25378285
  10. Glutamine stimulates the co-release of endogenous GLP-1 and PYY from mucosal L-cells resulting in paracrine GLP-1 and Y1 receptor-mediated electrogenic epithelial responses. PMID: 23992397
  11. Data suggest that an intestinal enteroendocrine cell line (STC-1) secrets PYY constitutively releasing PYY into cell culture media; linoleic acid and conjugated linoleic acid 9,11 are potent PYY secretagogues; most short-chain fatty acids are not. PMID: 22926626
  12. Suggest that PYY might be one critical mediator of deoxynivalenol-induced anorexia and, ultimately, growth suppression. PMID: 22903826
  13. gut peptide PYY is critical for the control of bone remodeling. PMID: 22792209
  14. a lineage of mature enteroendocrine cells have the ability to coexpress members of a group of functionally related peptides: CCK, secretin, GIP, GLP-1, PYY, and neurotensin PMID: 23064014
  15. PYY reduces food intake while enhancing lipogenic capacity and insulin action, likely contributing to fuel assimilation in the postprandial state. PMID: 22575886
  16. Data suggest that Pyy expression in hindbrain is regulated by nutritional factors and correlates with circulating PYY and leptin; Pyy decreases in acute starvation, prolonged caloric restriction, and after bariatric surgery (enterogastroanastomosis). PMID: 22761162
  17. PYY appears to regulate beta cell function and survival via the receptor Y(1/2). PMID: 22562022
  18. This study demonistrated that PYY has an important role in the regulation of olfactory neuron differentiation. PMID: 22354615
  19. dietary resistant starch is well tolerated, fermented in the colon, and stimulates colonic expression of proglucagon and PYY mRNA, and adiponectin protein in visceral fat. PMID: 22174009
  20. PYY(3-36) is also present in murine as well as in human saliva PMID: 22028819
  21. Gene expressions of ghrelin, PYY, and CCK was increased in the gastrointestinal tract of the hyperphagic intrauterine growth restriction rat offspring. PMID: 21264794
  22. PYY/PYY(3-36) potently inhibits basal and stress/serotonin/cholinergic-stimulated propulsive colonic motor function in conscious mice, likely via Y(2) receptors PMID: 19892938
  23. Langerhans cells and a certain BALB/c and A/J mice epidermis-derived dendritic cell line contain mRNA for peptide yy PMID: 12372697
  24. targeted disruption of the peptide YY gene does not perturb terminal endocrine cell differentiation or the control of food intake and energy homeostasis PMID: 15870288
  25. Data show that the sustained inhibition of gastric secretion due to tumours producing PYY/enteroglucagon in transgenic mice is associated with an increase in AQP4 expression and a down-regulation of H(+)/K(+)-ATPase in parietal cells. PMID: 15898955
  26. Reduced expression in gastrin-cholecystokinin knockout mice. PMID: 16002530
  27. reduced PYY levels may predispose to the development of obesity, particularly with ageing or under conditions of high-fat feeding, as demonstrated in peptie YY-deficient mice. PMID: 16680491
  28. We generated Pyy null mice, which were selectively resistant to the satiating and weight-reducing effects of protein and developed marked obesity that was reversed by exogenous PYY treatment. PMID: 16950139
  29. that PYY may be a mediator of islet cell development, as well as a cofactor for growth factor responses, not only during fetal pancreas formation but also during regeneration in adult mice. PMID: 17185798
  30. Overexpression of PYY by transgenic technique, chronic administration of PYY into normal pregnant mice, or deletion of the PYY Y1 receptor produced neural tube defects. PMID: 17400914
  31. Diet-induced obese mice had low plasma PYY, which may have caused compensatory up-regulation of PYY and Y2 receptor densities in medulla. PMID: 17615145
  32. Endogenous PYY plays a critical role in regulating bone mass. In comparison, its role in regulating body weight is minor and is confined to situations of high-fat feeding. PMID: 17920065
  33. Activation of neurons in the nucleus of the solitary tract following administration of T2R agonists to the GI tract involves CCK(1) and Y(2) receptors located on vagal afferent terminals in the gut wall. PMID: 18003792
  34. PYY-immunoreactive (ir) cell bodies were localized exclusively to the gigantocellular reticular nucleus (Gi) of the rostral medulla. The highest density of PYY fibers was present within the solitary tract nucleus. PMID: 18022952
  35. there was no effect of PYY transgenic over expression on basal or fasting-induced food intake PMID: 18164057

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
NPY family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*