Home
Protein
Recombinant Proteins
Recombinant Mouse Proepiregulin (Ereg), partial

Recombinant Mouse Proepiregulin (Ereg), partial

Code	CSB-MP730741MOr10
Abbreviation	Recombinant Mouse Ereg protein, partial
MSDS	MSDS Datasheet
Size	$118
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Target Names

Ereg

Uniprot No.

Q61521

Research Area

Others

Alternative Names

Ereg

Species

Mus musculus (Mouse)

Source

Mammalian cell

Expression Region

56-101aa

Target Protein Sequence

VQITKCSSDMDGYCLHGQCIYLVDMREKFCRCEVGYTGLRCEHFFL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

73.5 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-HSA-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Ligand of the EGF receptor/EGFR and ERBB4. Stimulates EGFR and ERBB4 tyrosine phosphorylation. Contributes to inflammation, wound healing, tissue repair, and oocyte maturation by regulating angiogenesis and vascular remodeling and by stimulating cell proliferation.

Gene References into Functions

Collectively, these data indicate that Yap-induced Epiregulin signaling promotes the identity of submandibular gland ductal progenitors and that removal of nuclear Yap by Lats1/2-mediated signaling is critical for proper ductal maturation. PMID: 28492365
High expression of EREG is associated with lung carcinogenesis. PMID: 28472347
The lack of the growth factor Ereg results in significantly reduced lung tumor development in a primary chemically induced tumor promotion model compared to wildtype controls (Ereg+/+ mice). PMID: 26894620
three-dimensional structure of the EPR antibody (the 9E5(Fab) fragment) in the presence and absence of EPR PMID: 26627827
Epiregulin promotes the proliferation of liver progenitor cells and DNA synthesis by hepatocytes and is upregulated in the serum of patients with liver injury. PMID: 24812054
EREG and tumor-associated fibroblasts play a crucial role in controlling tumor growth in colitis-associated neoplasms. PMID: 23549083
Epiregulin can effectively mature isolated cumulus-oocyte complexes, but fails as a substitute for the hCG/epidermal growth factor stimulus on cultured follicles. PMID: 19321658
Epiregulin plays a critical role in immune/inflammatory-related responses of keratinocytes and macrophages. PMID: 15365177
Data suggest that epiregulin (Ereg) deficiency does not alter intestinal cancer susceptibility, but that Ereg-null mice are highly susceptible to cancer-predisposing intestinal damage caused by oral dextran sulfate sodium. PMID: 15456865
Castration leads to adaptive increase in the concentrations of a subset of growth factors from the EGF network in the androgen sensitive CWR22 prostate cancer xenograft PMID: 15651060
Epiregulin may have a critical role in the regulation of peptidoglycan-mediated interleukin-6 production in antigen presenting cells and innate immunity. PMID: 16182244
Epiregulin appears as a new growth and insulinotropic factor in pancreatic beta cell lines. PMID: 16338791
Mycobacterium tuberculosis-infected macrophages play a pivotal role in TB-induced carcinogenesis by inducing DNA damage and by the production of a potent epidermal growth factor epiregulin responsible for squamous metaplasia and tumorigenesis. PMID: 19330024