Recombinant Mouse Putative phospholipase B-like 2 (Plbd2)

In Stock
Code CSB-EP663623MO
Abbreviation Recombinant Mouse Plbd2 protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Plbd2; Putative phospholipase B-like 2; EC 3.1.1.-; 66.3 kDa protein; 76 kDa protein; p76; LAMA-like protein 2; Lamina ancestor homolog 2; Phospholipase B domain-containing protein 2) [Cleaved into: Putative phospholipase B-like 2 28 kDa form; Putative phospholipase B-like 2 40 kDa form; Putative phospholipase B-like 2 15 kDa form]
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
47-594aa
Target Protein Sequence
LPTLGPGWQRQNPDPPVSRTRSLLLDAASGQLRLEDGFHPDAVAWANLTNAIRETGWAYLDLSTNGRYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKNFLEANLEWMQREMELNPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFTIKPLGFLLLQISGDLEDLEPALNKTNTKPSLGSGSCSALIKLLPGGHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPLVAGNNLVFSSYPGTIFSGDDFYILGSGLVTLETTIGNKNPALWKYVQPQGCVLEWIRNVVANRLALDGATWADVFKRFNSGTYNNQWMIVDYKAFLPNGPSPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIPYFETVFNASGLQALVAQYGDWFSYTKNPRAKIFQRDQSLVEDMDAMVRLMRYNDFLHDPLSLCEACNPKPNAENAISARSDLNPANGSYPFQALHQRAHGGIDVKVTSFTLAKYMSMLAASGPTWDQCPPFQWSKSPFHSMLHMGQPDLWMFSPIRVPWD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
65.9kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Could you please provide sequence, pricing, availability and tag information for all available sizes?
Have you received any customer feedback about the activity of this protein?

A:
Thanks for your inquiry.
Recombinant Mouse Putative phospholipase B-like 2(Plbd2)
CSB-EP663623MO >> E.coli
The product details are shown in the section of specification.
Regarding the activity, sorry, we haven't tested the activity of these proteins and also haven't received the feedback from other customers.
In theory, since what we provide is the full length of the mature protein, and we adopt affinity chromatography for puritication, which is purified under a very mild condition, it's very likely to be active.
Here is a literature for your reference: https://febs.onlinelibrary.wiley.com/doi/pdf/10.1016/j.febslet.2006.09.029
In addition, this protein is one of our best-selling proteins, the EP, YP, MP proteins have already been successfully developed and been ordered many times by other customers.
Theoretically, the protein expressed by the eukaryotic expression system should have much better biological activity.
Q:

Please can you tell me the concentration of CSB-EP663623MO?

A:
Thanks for your inquiry. The concentration of CSB-EP663623MO is 1mg/ml.

Target Background

Function
Putative phospholipase.
Gene References into Functions
  1. A 22-atom substructure of 21 intrinsic S atoms & 1 Xe atom with very low occupancy was found & refined at a resolution of 2.4A. The model was refined to an R(free) factor of 19.8%. The contribution of the Xe atom to the anomalous signal was negligible. PMID: 19237744
Subcellular Location
Lysosome lumen.
Protein Families
Phospholipase B-like family
Tissue Specificity
Present at highest levels in spleen, lung and brain (at protein level).
Database Links

KEGG: mmu:71772

UniGene: Mm.100065

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*