Recombinant Mouse Putative phospholipase B-like 2(Plbd2)

In Stock
Code CSB-EP663623MO
Product Type Recombinant Protein
Size US$235Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. Q3TCN2
Lead Time 3-7 business days
Relevance Putative phospholipase.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias 66.3 kDa protein76 kDa protein ;p76LAMA-like protein 2Lamina ancestor homolog 2;Phospholipase B domain-containing protein 2
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence LPTLGPGWQRQNPDPPVSRTRSLLLDAASGQLRLEDGFHPDAVAWANLTNAIRETGWAYLDLSTNGRYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKNFLEANLEWMQREMELNPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFTIKPLGFLLLQISGDLEDLEPALNKTNTKPSLGSGSCSALIKLLPGGHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPLVAGNNLVFSSYPGTIFSGDDFYILGSGLVTLETTIGNKNPALWKYVQPQGCVLEWIRNVVANRLALDGATWADVFKRFNSGTYNNQWMIVDYKAFLPNGPSPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIPYFETVFNASGLQALVAQYGDWFSYTKNPRAKIFQRDQSLVEDMDAMVRLMRYNDFLHDPLSLCEACNPKPNAENAISARSDLNPANGSYPFQALHQRAHGGIDVKVTSFTLAKYMSMLAASGPTWDQCPPFQWSKSPFHSMLHMGQPDLWMFSPIRVPWD
Research Area Others
Source E.coli
Gene Names Plbd2
Expression Region 47-594aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 65.9kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Putative phospholipase.
Subcellular Location Lysosome lumen
Protein Families Phospholipase B-like family
Tissue Specificity Present at highest levels in spleen, lung and brain (at protein level).
Database Links

KEGG: mmu:71772

UniGene: Mm.100065

Related Products

Plbd2 Antibodies

Plbd2 Antibodies for Mouse

Plbd2 Antibodies for Mus musculus (Mouse)

Plbd2 Proteins

Plbd2 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.