Code | CSB-EP663623MO |
Product Type | Recombinant Protein |
Size |
US$235Purchase it in Cusabio online store (only available for customers from the US) |
Uniprot No. | Q3TCN2 |
Lead Time | 3-7 business days |
Relevance | Putative phospholipase. |
Image | |
Storage Buffer | Tris-based buffer,50% glycerol |
Alias | 66.3 kDa protein76 kDa protein ;p76LAMA-like protein 2Lamina ancestor homolog 2;Phospholipase B domain-containing protein 2 |
Species | Mus musculus (Mouse) |
Purity | Greater than 90% as determined by SDS-PAGE. |
Sequence | LPTLGPGWQRQNPDPPVSRTRSLLLDAASGQLRLEDGFHPDAVAWANLTNAIRETGWAYLDLSTNGRYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKNFLEANLEWMQREMELNPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFTIKPLGFLLLQISGDLEDLEPALNKTNTKPSLGSGSCSALIKLLPGGHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPLVAGNNLVFSSYPGTIFSGDDFYILGSGLVTLETTIGNKNPALWKYVQPQGCVLEWIRNVVANRLALDGATWADVFKRFNSGTYNNQWMIVDYKAFLPNGPSPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIPYFETVFNASGLQALVAQYGDWFSYTKNPRAKIFQRDQSLVEDMDAMVRLMRYNDFLHDPLSLCEACNPKPNAENAISARSDLNPANGSYPFQALHQRAHGGIDVKVTSFTLAKYMSMLAASGPTWDQCPPFQWSKSPFHSMLHMGQPDLWMFSPIRVPWD |
Research Area | Others |
Source | E.coli |
Gene Names | Plbd2 |
Expression Region | 47-594aa |
Tag Info | N-terminal 6xHis-tagged |
Mol. Weight | 65.9kDa |
Protein Description | Full Length of Mature Protein |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Still Have Questions? | Leave a Message or Start an on-line Chat |
Plbd2 Antibodies for Mouse
Code | Product Name | Species Reactivity | Application |
---|---|---|---|
CSB-PA018125LA01MO | Plbd2 Antibody | Mouse | ELISA, WB |
Plbd2 Antibodies for Mus musculus (Mouse)
Code | Product Name | Species Reactivity | Application |
---|---|---|---|
CSB-PA018125LB01MO | Plbd2 Antibody, HRP conjugated | Mouse | ELISA |
CSB-PA018125LC01MO | Plbd2 Antibody, FITC conjugated | Mouse | ELISA |
CSB-PA018125LD01MO | Plbd2 Antibody, Biotin conjugated | Mouse | ELISA |
Plbd2 Proteins for Mus musculus (Mouse)
Code | Product Name | Source |
---|---|---|
CSB-YP663623MO | Recombinant Mouse Putative phospholipase B-like 2(Plbd2) | Yeast |
CSB-MP663623MO | Recombinant Mouse Putative phospholipase B-like 2(Plbd2) | Mammalian cell |
CSB-BP663623MO |
Recombinant Mouse Putative phospholipase B-like 2(Plbd2) | Baculovirus |
Recombinant Human Muscarinic acetylcholine receptor M3(CHRM3),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Mouse Tyrosine-protein kinase Lyn(Lyn)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human UV excision repair protein RAD23 homolog A(RAD23A)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Coagulation factor VII(F7),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Mouse Immunoglobulin J chain(Jchain)
Express system: E.coli
Species: Mus musculus (Mouse)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.