Recombinant Mouse Putative phospholipase B-like 2(Plbd2)

In Stock
Code CSB-EP663623MO
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. Q3TCN2
Lead Time 3-7 business days
Relevance Putative phospholipase.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias 66.3 kDa protein76 kDa protein ;p76LAMA-like protein 2Lamina ancestor homolog 2;Phospholipase B domain-containing protein 2
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence LPTLGPGWQRQNPDPPVSRTRSLLLDAASGQLRLEDGFHPDAVAWANLTNAIRETGWAYLDLSTNGRYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKNFLEANLEWMQREMELNPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFTIKPLGFLLLQISGDLEDLEPALNKTNTKPSLGSGSCSALIKLLPGGHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPLVAGNNLVFSSYPGTIFSGDDFYILGSGLVTLETTIGNKNPALWKYVQPQGCVLEWIRNVVANRLALDGATWADVFKRFNSGTYNNQWMIVDYKAFLPNGPSPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIPYFETVFNASGLQALVAQYGDWFSYTKNPRAKIFQRDQSLVEDMDAMVRLMRYNDFLHDPLSLCEACNPKPNAENAISARSDLNPANGSYPFQALHQRAHGGIDVKVTSFTLAKYMSMLAASGPTWDQCPPFQWSKSPFHSMLHMGQPDLWMFSPIRVPWD
Research Area Others
Source E.coli
Gene Names Plbd2
Expression Region 47-594aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 65.9kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Putative phospholipase.
Subcellular Location Lysosome lumen
Protein Families Phospholipase B-like family
Tissue Specificity Present at highest levels in spleen, lung and brain (at protein level).
Database Links

KEGG: mmu:71772

UniGene: Mm.100065

Q&A and Customer Reviews

Q&A
Q:

Could you please provide sequence, pricing, availability and tag information for all available sizes?
Have you received any customer feedback about the activity of this protein?

A:
Thanks for your inquiry.
Recombinant Mouse Putative phospholipase B-like 2(Plbd2)
CSB-EP663623MO >> E.coli
The product details are shown in the section of specification.
Regarding the activity, sorry, we haven't tested the activity of these proteins and also haven't received the feedback from other customers.
In theory, since what we provide is the full length of the mature protein, and we adopt affinity chromatography for puritication, which is purified under a very mild condition, it's very likely to be active.
Here is a literature for your reference: https://febs.onlinelibrary.wiley.com/doi/pdf/10.1016/j.febslet.2006.09.029
In addition, this protein is one of our best-selling proteins, the EP, YP, MP proteins have already been successfully developed and been ordered many times by other customers.
Theoretically, the protein expressed by the eukaryotic expression system should have much better biological activity.
Q:

Please can you tell me the concentration of CSB-EP663623MO?

A:
Thanks for your inquiry. The concentration of CSB-EP663623MO is 1mg/ml.
Customer Reviews

Related Products

Plbd2 Antibodies

Plbd2 Antibodies for Mouse

Plbd2 Antibodies for Mus musculus (Mouse)

Plbd2 Proteins

Plbd2 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.