Your Good Partner in Biology Research

Tel : 301-363-4651

Home
Protein
Recombinant Protein
Recombinant Mouse Putative phospholipase B-like 2(Plbd2)

Recombinant Mouse Putative phospholipase B-like 2(Plbd2)

^{In Stock}

Specification
Target

Code	CSB-EP663623MO
Product Type	Recombinant Protein
Size	US$2466Purchase it in Cusabio online store (Shop online in the US. Customers outside the US, please order from local distributors.)
Uniprot No.	Q3TCN2
Lead Time	3-7 business days
Relevance	Putative phospholipase.
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer	Tris-based buffer,50% glycerol
Alias	66.3 kDa protein76 kDa protein ;p76LAMA-like protein 2Lamina ancestor homolog 2;Phospholipase B domain-containing protein 2
Species	Mus musculus (Mouse)
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	LPTLGPGWQRQNPDPPVSRTRSLLLDAASGQLRLEDGFHPDAVAWANLTNAIRETGWAYLDLSTNGRYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKNFLEANLEWMQREMELNPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFTIKPLGFLLLQISGDLEDLEPALNKTNTKPSLGSGSCSALIKLLPGGHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPLVAGNNLVFSSYPGTIFSGDDFYILGSGLVTLETTIGNKNPALWKYVQPQGCVLEWIRNVVANRLALDGATWADVFKRFNSGTYNNQWMIVDYKAFLPNGPSPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIPYFETVFNASGLQALVAQYGDWFSYTKNPRAKIFQRDQSLVEDMDAMVRLMRYNDFLHDPLSLCEACNPKPNAENAISARSDLNPANGSYPFQALHQRAHGGIDVKVTSFTLAKYMSMLAASGPTWDQCPPFQWSKSPFHSMLHMGQPDLWMFSPIRVPWD
Research Area	Others
Source	E.coli
Gene Names	Plbd2
Expression Region	47-594aa
Tag Info	N-terminal 6xHis-tagged
Mol. Weight	65.9kDa
Protein Description	Full Length of Mature Protein
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions?	Leave a Message or Start an on-line Chat

Function	Putative phospholipase.
Subcellular Location	Lysosome lumen
Protein Families	Phospholipase B-like family
Tissue Specificity	Present at highest levels in spleen, lung and brain (at protein level).
Database Links	KEGG: mmu:71772 UniGene: Mm.100065

Q&A and Customer Reviews

Q&A

Could you please provide sequence, pricing, availability and tag information for all available sizes?
Have you received any customer feedback about the activity of this protein?

Thanks for your inquiry.
Recombinant Mouse Putative phospholipase B-like 2(Plbd2)
CSB-EP663623MO >> E.coli
The product details are shown in the section of specification.
Regarding the activity, sorry, we haven't tested the activity of these proteins and also haven't received the feedback from other customers.
In theory, since what we provide is the full length of the mature protein, and we adopt affinity chromatography for puritication, which is purified under a very mild condition, it's very likely to be active.
Here is a literature for your reference: https://febs.onlinelibrary.wiley.com/doi/pdf/10.1016/j.febslet.2006.09.029
In addition, this protein is one of our best-selling proteins, the EP, YP, MP proteins have already been successfully developed and been ordered many times by other customers.
Theoretically, the protein expressed by the eukaryotic expression system should have much better biological activity.

Please can you tell me the concentration of CSB-EP663623MO?

Thanks for your inquiry. The concentration of CSB-EP663623MO is 1mg/ml.

Hide All

Customer Reviews

Submit CUSABIO Product Reciew in 2 Minutes, Win An Apple Watch!

Related Products

Plbd2 Antibody

Plbd2 Protein

Plbd2 Antibodies

Plbd2 Antibodies for Mouse

Code	Product Name	Species Reactivity	Application
CSB-PA018125LA01MO	Plbd2 Antibody	Mouse	ELISA, WB

Plbd2 Antibodies for Mus musculus (Mouse)

Code	Product Name	Species Reactivity	Application
CSB-PA018125LB01MO	Plbd2 Antibody, HRP conjugated	Mouse	ELISA
CSB-PA018125LC01MO	Plbd2 Antibody, FITC conjugated	Mouse	ELISA
CSB-PA018125LD01MO	Plbd2 Antibody, Biotin conjugated	Mouse	ELISA

Plbd2 Proteins

Plbd2 Proteins for Mus musculus (Mouse)

Code	Product Name	Source
CSB-YP663623MO	Recombinant Mouse Putative phospholipase B-like 2(Plbd2)	Yeast
CSB-MP663623MO	Recombinant Mouse Putative phospholipase B-like 2(Plbd2)	Mammalian cell
CSB-BP663623MO	Recombinant Mouse Putative phospholipase B-like 2(Plbd2)	Baculovirus

Most popular with customers

Recombinant Human Myosin-6(MYH6),partial

Express system: Yeast

Species: Homo sapiens (Human)
Recombinant Dog Caveolin-1(CAV1)

Express system: Yeast

Species: Canis lupus familiaris (Dog) (Canis familiaris)
Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 6(CEACAM6)

Express system: E.coli

Species: Homo sapiens (Human)
Recombinant Human Proteasome subunit beta type-10(PSMB10)

Express system: E.coli

Species: Homo sapiens (Human)
Recombinant Human Ribose-phosphate pyrophosphokinase 1(PRPS1)

Express system: E.coli

Species: Homo sapiens (Human)
Recombinant Human ATP synthase subunit beta, mitochondrial(ATP5F1B)

Express system: Yeast

Species: Homo sapiens (Human)
Recombinant Human Clathrin light chain A(CLTA)

Express system: E.coli

Species: Homo sapiens (Human)
Recombinant Human C4b-binding protein alpha chain(C4BPA)

Express system: Yeast

Species: Homo sapiens (Human)

Product Center

Kit

Protein

Antibody

Molecular Biology Product

Small Molecule

Protein FAQs CUSABIO's Five Expression Systems General Information of Different Tags Production of Recombinant Protein How to Choose A Suitable Expression Vector? How to Express A Protein with Bioactivity? Applications of Recombinant Proteins

Promotions

Products
Service
Technical Resources
Research Tools
About Us
Contact Us
- CUSABIO TECHNOLOGY LLC
- Tel: 301-363-4651
- Email: support@cusabio.com
Join Us with

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How did you know this promotion?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Recombinant Mouse Putative phospholipase B-like 2(Plbd2)

Specification

Target