Recombinant Mouse Ras GTPase-activating-like protein IQGAP1 (Iqgap1), partial

Code CSB-EP881333MO
Abbreviation Recombinant Mouse Iqgap1 protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Iqgap1
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
962-1345aa
Target Protein Sequence
SKEKREKLEAYQHLFYLLQTNPTYLAKLIFQMPQNKSTKFMDSVIFTLYNYASNQREEYLLLRLFQTALQEEIKSKVDQIQEIVTGNPTVIKMVVSFNRGARGQNALRQILAPVVKEIMDDKSLNIKTDPVDIYKSWVNQMESQTGEASKLPYDVTPEQALSHEEVKTRLDNSIRNMRAVTDKFLSAIVSSVDKIPYGMRFIAKVLKDSLHEKFPDAGEDELLKIIGNLLYYRYMNPAIVAPDAFDIIDLSAGGQLTTDQRRNLGSIAKMLQHAASNKMFLGDNAHLSIINEYLSQSYQKFRRFFQVACDVPELQDKFNVDEYSDLVTLTKPVIYISIGEIINTHTLLLDHQDAIAPEHNDPIHELLDDLGEVPTIESLIGESC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
50.7 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a crucial role in regulating the dynamics and assembly of the actin cytoskeleton. Binds to activated CDC42 but does not stimulate its GTPase activity. It associates with calmodulin. Could serve as an assembly scaffold for the organization of a multimolecular complex that would interface incoming signals to the reorganization of the actin cytoskeleton at the plasma membrane. May promote neurite outgrowth. May play a possible role in cell cycle regulation by contributing to cell cycle progression after DNA replication arrest.
Gene References into Functions
  1. over-expression of IQGAP1 in human head and neck squamous cell carcinoma may indicate poor prognosis. PMID: 29846864
  2. Alterations in IQGAP1 signalling promote the emergence of cancer stem cells and gastric adenocarcinoma development in the context of an H. pylori infection. PMID: 27729612
  3. propose that the GRD and CT domains regulate IQGAP1 localization to retracting actin networks to promote a tumorigenic role in melanoma cells PMID: 29240845
  4. Data highlight a unique mechanism of formin action in which mDia1 and INF2 function in series to stabilize MTs and point to IQGAP1 as a scaffold that facilitates the activation of one formin by another. PMID: 27030671
  5. Hectd1 regulates the protein level of IQGAP1 through ubiquitination. PMID: 28073378
  6. Loss of IQGAP1 results in impaired insulin signaling and glucose homeostasis in vivo. PMID: 28082684
  7. IQGAP1 has a strong signaling relationship with Ras genes in induction of cancer and it is considered as a key gene for induction or suppression of the hepatocellular carcinoma. PMID: 26464624
  8. IQGAP1 has the potential to modulate airway contraction severity in acute asthma. PMID: 25271629
  9. we propose that IQGAP1 acts as a small GTPase scaffolding platform within the small GTPase network, and recruits and/or regulates small GTPases, small GTPase regulators and effectors to orchestrate cell behavior PMID: 24355937
  10. This finding has new implications for involvement of IQGAP1 in cell polarization and migration events and potentially in cell cycle-associated nuclear envelope assembly/disassembly. PMID: 22964981
  11. IQGAP1 contributes to AngII-induced apoptosis of podocytes by interacting with the ERK1/2 signaling protein PMID: 24247724
  12. RSPO-LGR4 not only induces the clearance of RNF43/ZNRF3 to increase Wnt receptor levels but also recruits IQGAP1 into the Wnt signaling complex. PMID: 24639526
  13. IQGAP1 is upregulated in pre-existed sparing neurons of the CA1 layer undergoing morphological changes after excitoxicity-induced hippocampal CA3 neuronal death. PMID: 23907317
  14. activation of Cdc42 in response to the insulin secretagogue glucose recruits endocytic machinery to IQGAP1 at the cell periphery and regulates endocytosis at this membrane site. PMID: 24100016
  15. IQGAP1 has an essential role in RAS-driven tumorigenesis in mouse and human tissue PMID: 23603816
  16. Review. IQGAP family members have an important role in neuronal development, synaptic plasticity and nervous system disorders involving alterations in spine density. PMID: 23018238
  17. IQGAP1 localized to the endothelial cell-cell junction after sphingosine-1-phosphate (S1P) treatment. PMID: 22561460
  18. Phosphoinositide module is defined by a C-terminal 105-107 amino acid region of which IQGAP1 and -2, but not IQGAP3, binds preferentially to phosphatidylinositol 3,4,5-trisphosphate (PtdInsP(3)). PMID: 22493426
  19. our data suggest that IQGAP1 acts as a dual negative regulator in T cells, limiting both TCR-mediated activation kinetics and F-actin dynamics via distinct mechanisms. PMID: 22573807
  20. [review] IQGAP1 possesses multiple protein interaction motifs to achieve its scaffolding functions in this summary of recent developments and exciting new findings of cellular functions of IQGAP1. PMID: 22345702
  21. These results suggest that DGKzeta is involved in IQGAP1/Rac1-mediated phagocytosis upon LPS stimulation in macrophages. PMID: 22450320
  22. the scaffolding function of IQGAP1, which integrates Rac1 and MAPK signalling, is usurped by Salmonella during cell invasion PMID: 21851337
  23. On the basis of these findings, we propose that a dysfunctional IQGAP1 gene contributes to the cognitive deficits in brain disorders characterized by fewer dendritic spines. PMID: 21653857
  24. Upon activation, Rap1b colocalized with the scaffolding protein IQGAP1. PMID: 20733035
  25. IQGAP1 is a potential target protein of S100B during processes of dynamic rearrangement of cell membrane morphology PMID: 12377780
  26. IQGAP is potential regulator of E-cadherin-catenin interactions during murine preimplantation development PMID: 12617831
  27. IQGAP1 has a fundamental role in cell motility and invasion PMID: 12900413
  28. IQGAP1 is an important modulator of normal hemostasis PMID: 15026422
  29. in motile cells beta-catenin is recruited by IQGAP1 and N-cadherin to active membrane ruffles, wherein beta-catenin mediates the internalization and possible recycling of the membrane-associated proteins N-cadherin and APC PMID: 17255093
  30. VEGF synthesized by astrocytes could be involved in the guidance of neural progenitors to neurogenic niches and that IQGAP1 is an effector of the VEGF-dependent migratory signal PMID: 17460084
  31. Iqgap1 modulates activation of B-RAf. PMID: 17563371
  32. Dia1 and Iqgap1 interact in cell migration and phagocytic cup formation. PMID: 17620407
  33. Development of hepatocellular carcinoma in Iqgap2-deficient mice is Iqgap1 dependent. PMID: 18180285
  34. IQGAP1 associates and co-localizes with the exocyst-septin complex, and influences the localization of the exocyst and the organization of septin. PMID: 18216334
  35. The site-specific expression pattern of this potent modulator of multiple biological pathways in the renal tubules suggests that IQGAP1 may have multiple important roles in various renal functions. PMID: 18413651
  36. the scaffold protein IQGAP1 couples Ca(2+) and calmodulin signaling to B-Raf function PMID: 18567582

Show More

Hide All

Subcellular Location
Cell membrane. Nucleus. Cytoplasm. Note=Subcellular distribution is regulated by the cell cycle, nuclear levels increase at G1/S phase (PubMed:20883816).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*