Recombinant Mouse Regenerating islet-derived protein 3-gamma(Reg3g)

Code CSB-EP019549MO
Product Type Recombinant Protein
Size US$2466
Uniprot No. O09049
Relevance Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota. The uncleaved form has bacteriostatic activity, whereas the cleaved form has bactericidal activity against L.monocytogenes and methicillin-resistant S.aureus. Regulates keratinocyte proliferation and differentiation after skin injury
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Pancreatitis-associated protein 3Regenerating islet-derived protein III-gamma ;Reg III-gamma
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence EVAKKDAPSSRSSCPKGSRAYGSYCYALFSVSKNWYDADMACQKRPSGHLVSVLSGAEASFLSSMIKSSGNSGQYVWIGLHDPTLGYEPNRGGWEWSNADVMNYINWETNPSSSSGNHCGTLSRASGFLKWRENYCNLELPYVCKFKA
Research Area Others
Source E.coli
Gene Names Reg3g
Expression Region 27-174aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 20.3kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota. The uncleaved form has bacteriostatic activity, whereas the cleaved form has bactericidal activity against L.monocytogenes and methicillin-resistant S.aureus. Regulates keratinocyte proliferation and differentiation after skin injury.
Subcellular Location Secreted, Cytoplasm
Tissue Specificity Predominantly expressed in the small intestine, including Paneth cells (at protein level). Hardly detectable in the colon (at protein level). Highly expressed in the lung epithelium during methicillin-resistant S.aureus infection (at protein level). Skin
Database Links

KEGG: mmu:19695

STRING: 10090.ENSMUSP00000032089

UniGene: Mm.252385

Q&A and Customer Reviews

Q&A
Q:

I have another protein question for you.I would like to know if it is necessary to remove the His tag from this protein prior to their experiment.Is there a standard protocol for tag removal that your laboratory would recommend?

A:
Thanks for your inquiry.
1. This protein is N-terminal 6xHis-tagged. This tag is very small which will not affect your experiment in theory. If your want to remove the tag, they could try, and we have successfully remove the tag from this protein before.
2. Thrombin cleavage site has been added between the tag and the target protein when this protein was designed, you can choose thrombin for cleavage.
3. You could purchase thrombin and remove the tag according to product operation instructions.
Customer Reviews

Related Products

Reg3g Antibodies

Reg3g Antibodies for Mus musculus (Mouse)

Reg3g Proteins

Reg3g Proteins for Mus musculus (Mouse)

Reg3g ELISA Kit

Reg3g ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.