Recombinant Mouse Regenerating islet-derived protein 3-gamma (Reg3g), partial

In Stock
Code CSB-YP019549MO
Abbreviation Recombinant Mouse Reg3g protein
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Reg3g
Uniprot No.
Research Area
Others
Alternative Names
Reg3g; Pap3; Regenerating islet-derived protein 3-gamma; REG-3-gamma; Pancreatitis-associated protein 3; Regenerating islet-derived protein III-gamma; Reg III-gamma) [Cleaved into: Regenerating islet-derived protein 3-gamma 16.5 kDa form; Regenerating islet-derived protein 3-gamma 15 kDa form]
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
27-174aa
Target Protein Sequence
EVAKKDAPSSRSSCPKGSRAYGSYCYALFSVSKNWYDADMACQKRPSGHLVSVLSGAEASFLSSMIKSSGNSGQYVWIGLHDPTLGYEPNRGGWEWSNADVMNYINWETNPSSSSGNHCGTLSRASGFLKWRENYCNLELPYVCKFKA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
18.3kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota. The uncleaved form has bacteriostatic activity, whereas the cleaved form has bactericidal activity against L.monocytogenes and methicillin-resistant S.aureus. Regulates keratinocyte proliferation and differentiation after skin injury.
Gene References into Functions
  1. the secretion of regenerating islet-derived IIIgamma (RegIIIgamma) is responsible for the protective effect of Adipose-derived stem cells. PMID: 26866937
  2. The study shows that cardiac stress activates Reg3gamma expression and p38 MAPK is an upstream regulator of Reg3gamma gene expression in heart. Altogether the data suggest Reg3gamma is associated with cardiac inflammatory signaling. PMID: 27798352
  3. regenerating islet-derived gene gamma promotes beta cell regeneration and preserves beta cells from autoimmunity damage by increasing regulatory T cell differentiation and inducing tolerated dendritic cells. PMID: 26667474
  4. Recombinant IFN-I or IFN-I expression induced by RIG-I promoted growth of intestinal organoids in vitro and production of the antimicrobial peptide regenerating islet-derived protein 3 gamma (RegIIIgamma). PMID: 28424327
  5. REG3gamma-deficient mice have altered mucus distribution and increased mucosal inflammatory responses to the microbiota and enteric pathogens in the ileum. PMID: 24345802
  6. antibacterial function for lung epithelium through Stat3-mediated induction of Reg3gamma. PMID: 23401489
  7. Reg-IIIgamma expression is mainly observed in epithelial cells of the airways and intestine, but not in the nervous system; expression levels show a gradually increasing pattern along with development. PMID: 21681751
  8. Letter: aggregation status of PAP1 and PAP2 could change their role in regulating the inflammation in acute pancreatitis. PMID: 21926556
  9. findings show that RegIIIgamma is essential for maintaining a ~50-micrometer zone that physically separates the microbiota from the small intestinal epithelial surface PMID: 21998396
  10. findings show that RegIIIgamma and its human counterpart, HIP/PAP, are directly antimicrobial proteins that bind their bacterial targets via interactions with peptidoglycan carbohydrate PMID: 16931762
  11. antibacterial activities of mouse RegIIIgamma and its human ortholog, HIP/PAP, are tightly controlled by an inhibitory N-terminal prosegment that is removed by trypsin in vivo. PMID: 19095652

Show More

Hide All

Subcellular Location
Secreted. Cytoplasm.
Tissue Specificity
Predominantly expressed in the small intestine, including Paneth cells (at protein level). Hardly detectable in the colon (at protein level). Highly expressed in the lung epithelium during methicillin-resistant S.aureus infection (at protein level). Skin
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*