Recombinant Mouse Endoribonuclease ZC3H12A (Zc3h12a)

Code CSB-YP704737MO
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP704737MO-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP704737MO
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP704737MO
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
Zc3h12a; Mcpip; Mcpip1; Endoribonuclease ZC3H12A; EC 3.1.-.-; Monocyte chemotactic protein-induced protein 1; MCP-induced protein 1; MCPIP-1; Regnase-1; Reg1; Zinc finger CCCH domain-containing protein 12A
Species
Mus musculus (Mouse)
Expression Region
1-596
Target Protein Sequence
MSDPCGTKPVQESNPTMSLWSLEDRHSSQGRPQPDQDPVAKEAPTSELQMKVDFFRKLGY SSSEIHSVLQKLGVQADTNTVLGELVKHGSATERECQALTAPSPQPPLVPRGGSTPKPST LEPSLPEEDREGSDLRPVVIDGSNVAMSHGNKEVFSCRGILLAVNWFLERGHTDITVFVP SWRKEQPRPDVPITDQHILRELEKKKILVFTPSRRVGGKRVVCYDDRFIVKLAFESDGVV VSNDTYRDLQGERQEWKRFIEERLLMYSFVNDKFMPPDDPLGRHGPSLDNFLRKKPLPSE HRKQPCPYGKKCTYGIKCRFFHPERPSRPQRSVADELRANALLSPPRTPVKDKSSQRPSP ASQSSSVSLEAEPGSLDGKKLGARSSPGPHREGSPQTCAPAGRSLPVSGGSFGPTEWLAH TQDSLPYTSQECLDSGIGSLESQMSELWGVRGGSPGESGPTRGPYAGYHSYGSKVPAAPS FSPFRPAMGAGHFSVPTDYVPPPPTYPSREYWSEPYPLPPPTPVLQEPQRPSPGAGGGPW GRVGDLAKERAGVYTKLCGVFPPHLVEAVMRRFPQLLDPQQLAAEILSYKSQHLSE
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Endoribonuclease involved in various biological functions such as cellular inflammatory response and immune homeostasis, glial differentiation of neuroprogenitor cells, cell death of cardiomyocytes, adipogenesis and angiogenesis. Functions as an endoribonuclease involved in mRNA decay. Modulates the inflammatory response by promoting the degradation of a set of translationally active cytokine-induced inflammation-related mRNAs, such as IL6 and IL12B, during the early phase of inflammation. Prevents aberrant T-cell-mediated immune reaction by degradation of multiple mRNAs controlling T-cell activation, such as those encoding cytokines (IL6 and IL2), cell surface receptors (ICOS, TNFRSF4 and TNFR2) and transcription factor (REL). Inhibits cooperatively with ZC3H12A the differentiation of helper T cells Th17 in lungs. They repress target mRNA encoding the Th17 cell-promoting factors IL6, ICOS, REL, IRF4, NFKBID and NFKBIZ. The cooperation requires RNA-binding by RC3H1 and the nuclease activity of ZC3H12A. Together with RC3H1, destabilizes TNFRSF4/OX40 mRNA by binding to the conserved stem loop structure in its 3'UTR. Self regulates by destabilizing its own mRNA. Cleaves mRNA harboring a stem-loop (SL), often located in their 3'-UTRs, during the early phase of inflammation in a helicase UPF1-dependent manner. Plays a role in the inhibition of microRNAs (miRNAs) biogenesis. Cleaves the terminal loop of a set of precursor miRNAs (pre-miRNAs) important for the regulation of the inflammatory response leading to their degradation, and thus preventing the biosynthesis of mature miRNAs. Plays also a role in promoting angiogenesis in response to inflammatory cytokines by inhibiting the production of antiangiogenic microRNAs via its anti-dicer RNase activity. Affects the overall ubiquitination of cellular proteins. Positively regulates deubiquitinase activity promoting the cleavage at 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains on TNF receptor-associated factors (TRAFs), preventing JNK and NF-kappa-B signaling pathway activation, and hence negatively regulating macrophage-mediated inflammatory response and immune homeostasis. Induces also deubiquitination of the transcription factor HIF1A, probably leading to its stabilization and nuclear import, thereby positively regulating the expression of proangiogenic HIF1A-targeted genes. Involved in a TANK-dependent negative feedback response to attenuate NF-kappaB activation through the deubiquitination of IKBKG or TRAF6 in response to interleukin-1-beta (IL1B) stimulation or upon DNA damage. Prevents stress granules (SGs) formation and promotes macrophage apoptosis under stress conditions, including arsenite-induced oxidative stress, heat shock, and energy deprivation. Plays a role in the regulation of macrophage polarization; promotes IL4-induced polarization of macrophages M1 into anti-inflammatory M2 state. May also act as a transcription factor that regulates the expression of multiple genes involved in inflammatory response, angiogenesis, adipogenesis and apoptosis. Functions as a positive regulator of glial differentiation of neuroprogenitor cells through an amyloid precursor protein (APP)-dependent signaling pathway. Attenuates septic myocardial contractile dysfunction in response to lipopolysaccharide (LPS) by reducing I-kappa-B-kinase (IKK)-mediated NF-kappa-B activation, and hence myocardial proinflammatory cytokine production.
Gene References into Functions
  1. Regnase-1 predominantly regulates mTORC1 signaling. PMID: 30297433
  2. Thus, these data suggest MCPIP1 as a potent host defense against Coxsackievirus B3 infection and viral myocarditis. PMID: 29043433
  3. MCPIP1 overexpression results in modulated levels of 58 miRNAs in adipocytes on day 2 of differentiation. Among them, 30 miRNAs showed significantly reduced levels and 28 showed increased levels in comparison to control. Approximately one third of the modulated miRNAs were not previously reported to be involved in adipocytes differentiation. PMID: 28939056
  4. duodenal Regnase-1 controls the expression of PHD3, which impairs duodenal iron uptake via HIF2alpha suppression. PMID: 28538180
  5. mutations of both Regnase-1 and Roquin in T cells leads to massive lymphocyte activation and increased TH1 cells. In contrast, mutation of either Regnase-1 or Roquin affected T cell activation to a lesser extent than the double mutation, indicating that Regnase-1 and Roquin function nonredundantly in T cells. Regnase-1 is capable of repressing Roquin mRNA. PMID: 29127149
  6. our findings not only demonstrate that MCPIP1 plays an important role in early cortical neurogenesis but also reveal an unexpected link between neocortical development, immune regulators, and epigenetic modification. PMID: 27523618
  7. MCPIP1 is a potent negative regulator of psoriatic skin inflammation through IL-17A and IL-17C PMID: 27920272
  8. IL-17A-mediated induction of MCPIP1 is involved in the regulation of local altered gene expression in suprabasal epidermal layers in psoriasis PMID: 27180111
  9. this study shows that Regnase-1 RNase activity is tightly controlled by both intramolecular and intermolecular interactions PMID: 26927947
  10. Overexpression of MCPIP1 induced apoptosis. PMID: 26833120
  11. MCPIP1 is the target of mmu-miR-27-5p. PMID: 26295043
  12. MCPIP1-MSCs also expressed increased levels of proteins involved in angiogenesis, autophagy, and induction of differentiation PMID: 26214508
  13. This studies demonstrated that MCPIP1 is an important mediator of minocycline-induced protection from brain ischemia. PMID: 25888869
  14. Data indicate that MCPIP1 (also termed Regnase-1, encoded by Zc3h12a) knockdown enhanced interleukin-17 (IL-17)-mediated signaling. PMID: 26320658
  15. MCPIP expression in the ischemic myocardium protects against adverse cardiac remodeling and dysfunction following myocardial infarction PMID: 25840774
  16. both in vivo and in vitro experiments demonstrate that the transcription factors STAT6 and KLF4 implement IL-4-induced M2 polarization via the dual catalytic activities of MCPIP. PMID: 25934862
  17. Findings reveal that differential regulation of mRNAs by Regnase-1 and Roquin depends on their translation status and enables elaborate control of inflammation. PMID: 26000482
  18. Regnase-1 is a key molecule in the regulation of immune responses PMID: 24163394
  19. Roquin inhibited T(H)17 cell differentiation and acted together with the endoribonuclease regnase-1 to repress target mRNA encoding the T(H)17 cell-promoting factors IL-6, ICOS, c-Rel, IRF4, IkappaBNS and IkappaBzeta. PMID: 25282160
  20. MCPIP1 deficiency in mice results in severe anemia related to autoimmune mechanisms. PMID: 24324805
  21. Hematopoietic deficiency of MCPIP1 resulted in severe systemic and multi-organ inflammation but paradoxically diminished atherogenesis in mice. PMID: 24223214
  22. these data confirm that MCPIP1 is a key regulator of adipogenesis. PMID: 24418043
  23. these results suggest a prominent role for MCPIP1 in the control of inflammation and immune homeostasis. PMID: 23567898
  24. MCPIP1 deficiency caused significant lack of electroacupuncture pretreatment-induced cerebral protective effects PMID: 23663236
  25. MCPIP1 selectively suppresses TLR4 signaling pathway and protects mice from LPS-induced septic shock. PMID: 23422584
  26. MCPIP1 is regulated by IL-17 and IL-1 PMID: 23658019
  27. These results indicate that dynamic control of Regnase-1 expression in T cells is critical for controlling T cell activation. Manipulation of Malt1-mediated Regnase-1 expression appears to be an important contrcontrol point for T-cell-mediated immune responses in vivo. PMID: 23706741
  28. MICIP is found in rheumatoid arthritis leading to endothelial dysfunction. PMID: 23580143
  29. these results implicate MCPIP1 as a potent regulator of innate immunity, which can be strongly engaged in the pathogenesis of acute and chronic infective diseases. PMID: 22777400
  30. MCPIP induces adipogenesis via induction of reactive oxygen/nitrogen species that leads to endoplasmic reticulum stress. PMID: 22739135
  31. Data indicate that absence of MCPIP1 exacerbates ischemic brain damage by upregulation of proinflammatory cytokines and that MCPIP1 participates in LPS-induced ischemic stroke tolerance. PMID: 22196138
  32. MCPIP1 coordinates SG formation and apoptosis during cellular stress and may play a critical role in immune homeostasis and resolution of macrophage inflammation. PMID: 21971051
  33. MCPIP has therapeutic values to protect heart from inflammatory pathologies. PMID: 21616078
  34. Data show that MCPIP1 negatively regulates c-Jun N-terminal kinase (JNK) and NF-kappaB activity by removing ubiquitin moieties from proteins, including TRAF2, TRAF3, and TRAF6. PMID: 21115689
  35. MCPIP1, 2, 3, and 4, encoded by four genes, Zc3h12a, Zc3h12b, Zc3h12c, and Zc3h12d, respectively, regulates macrophage activation. PMID: 18178554
  36. results indicate that Zc3h12a is an essential RNase that prevents immune disorders by directly controlling the stability of a set of inflammatory genes PMID: 19322177
  37. MCP-1 (monocyte chemotactic protein-1)-induced protein is a newly identified protein that can induce adipogenesis without PPARgamma. PMID: 19666473
  38. It is a novel RNase and regulates inflammatory responses via regulating the gene expression of mRNA coding IL-6. (review) PMID: 19894584

Show More

Hide All

Involvement in disease
Increased expression of ZC3H12A is associated with ischemic heart disease (PubMed:16574901).
Subcellular Location
Nucleus. Cytoplasm. Rough endoplasmic reticulum membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasmic granule. Cytoplasm, P-body.
Protein Families
ZC3H12 family
Tissue Specificity
Expressed in CD4(+) helper T-cells (at protein level). Highly expressed in macrophages. Expressed in lung, lymph nodes, spleen and thymus. Expressed weakly in heart. Expressed weakly in cardiomyocytes (at protein level). Expressed in spleen, lung, intesti
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1