Recombinant Mouse Sialidase-1 (Neu1)

In Stock
Code CSB-EP015717MO
Abbreviation Recombinant Mouse Neu1 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Microbiology
Alternative Names
Neu1; Neu; Sialidase-1; EC 3.2.1.18; G9 sialidase; Lysosomal sialidase; N-acetyl-alpha-neuraminidase 1
Species
Mus musculus(Mouse)
Source
E.coli
Expression Region
42-409aa
Target Protein Sequence
EDDFSLVQPLVTMEQLLWVSGKQIGSVDTFRIPLITATPRGTLLAFAEARKKSASDEGAKFIAMRRSTDQGSTWSSTAFIVDDGEASDGLNLGAVVNDVDTGIVFLIYTLCAHKVNCQVASTMLVWSKDDGISWSPPRNLSVDIGTEMFAPGPGSGIQKQREPGKGRLIVCGHGTLERDGVFCLLSDDHGASWHYGTGVSGIPFGQPKHDHDFNPDECQPYELPDGSVIINARNQNNYHCRCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGALATSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWQKERVQVWPGPSGYSSLTALENSTDGKKQPPQLFVLYEKGLNRYTESISMVKISVYGTL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
46.3 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The plasmid vector incorporates the mouse Sialidase-1 (Neu1) protein (42-409aa) encoding gene and the N-terminal 10xHis-tag gene, generating the recombinant plasmid, which is then introduced into E.coli cells. Selection of positive E.coli cells is based on their capacity to withstand a particular antibiotic. Subsequently, the E.coli cells containing the recombinant plasmid are cultivated under conditions that facilitate the expression of the mouse Neu1. Following expression, affinity purification is employed to isolate and purify the recombinant mouse Neu1 protein from the cell lysate. Denaturing SDS-PAGE is used to resolve the resulting recombinant protein, enabling an estimation of its purity, exceeding 85%.

Neu1, also known as neuraminidase 1, is an enzyme found in lysosomes, essential for breaking down sialylated glycoconjugates [1]. It's particularly effective against short sugar chains and small protein-sugar complexes [1]. Neu1 shows increased activity when monocytes transform into macrophages, indicating its importance in macrophage function and immune response [2]. It's also involved in regulating insulin signaling [3], managing energy use and stress in heart cells after a heart attack [4], and promoting insulin signaling [5]. Moreover, Neu1 seems to influence immune response, tissue elasticity, and cell growth [5]. It can even alter the signals of Toll-like receptors, impacting the response to certain infections [6]. In some cancers, like melanoma, Neu1 may have a role, although it's not fully clear yet [7]. This enzyme is made in the endoplasmic reticulum, then modified and activated with the help of another protein, protective protein/cathepsin A (PPCA) [8][9][10]. Neu1 also affects microglial activation and contributes to inflammatory processes in diseases like aortic dissection [11][12]. In certain bladder cancers, Neu1 slows down cancer cell growth by interfering with specific protein interactions and signaling pathways [13]. It's also linked to changes in receptors that control the release of fat-related hormones, hinting at a role in regulating fat tissue functions [14].

References:
[1] V. Seyrantepe, K. Landry, S. Trudel, J. Hassan, C. Morales, & A. Pshezhetsky, "Neu4, a novel human lysosomal lumen sialidase, confers normal phenotype to sialidosis and galactosialidosis cells", Journal of Biological Chemistry, vol. 279, no. 35, p. 37021-37029, 2004. https://doi.org/10.1074/jbc.m404531200
[2] F. Liang, V. Seyrantepe, K. Landry, R. Ahmad, A. Ahmad, N. Stamatoset al., "Monocyte differentiation up-regulates the expression of the lysosomal sialidase, neu1, and triggers its targeting to the plasma membrane via major histocompatibility complex class ii-positive compartments", Journal of Biological Chemistry, vol. 281, no. 37, p. 27526-27538, 2006. https://doi.org/10.1074/jbc.m605633200
[3] L. Dridi, V. Seyrantepe, A. Fougerat, X. Pan, É. Bonneil, P. Thibaultet al., "Positive regulation of insulin signaling by neuraminidase 1", Diabetes, vol. 62, no. 7, p. 2338-2346, 2013. https://doi.org/10.2337/db12-1825
[4] Z. Guo, D. Fan, F. Liu, S. Ma, P. An, D. Yanget al., "Neu1 regulates mitochondrial energy metabolism and oxidative stress post-myocardial infarction in mice via the sirt1/pgc-1 alpha axis", Frontiers in Cardiovascular Medicine, vol. 9, 2022. https://doi.org/10.3389/fcvm.2022.821317
[5] A. Khan and C. Sergi, "Neu1—a unique therapeutic target for alzheimer’s disease", Frontiers in Pharmacology, vol. 13, 2022. https://doi.org/10.3389/fphar.2022.902259
[6] J. Karmakar, S. Roy, & C. Mandal, "Modulation of tlr4 sialylation mediated by a sialidase neu1 and impairment of its signaling in leishmania donovani infected macrophages", Frontiers in Immunology, vol. 10, 2019. https://doi.org/10.3389/fimmu.2019.02360
[7] P. Qiu, L. Gao, H. Cheng, J. Wang, & J. Wang, "Sialidase neu1 may serve as a potential biomarker of proliferation, migration and prognosis in melanoma", World Journal of Oncology, vol. 13, no. 4, p. 222-234, 2022. https://doi.org/10.14740/wjon1509
[8] J. Tsukimoto, Y. Takeuchi, Y. Horii, T. Iniwa, Y. Fukushi, S. Nishiokaet al., "In cellulo crystallization of human neuraminidase 1 and biological roles of n-glycans", Acs Applied Bio Materials, vol. 5, no. 1, p. 205-213, 2021. https://doi.org/10.1021/acsabm.1c01043
[9] E. Bonten, G. Yogalingam, H. Hu, E. Gomero, D. Vlekkert, & A. d’Azzo, "Chaperone-mediated gene therapy with recombinant aav-ppca in a new mouse model of type i sialidosis", Biochimica Et Biophysica Acta (Bba) - Molecular Basis of Disease, vol. 1832, no. 10, p. 1784-1792, 2013. https://doi.org/10.1016/j.bbadis.2013.06.002
[10] D. Wang, S. Zaitsev, G. Taylor, A. d'Azzo, & E. Bonten, "Protective protein/cathepsin a rescues n-glycosylation defects in neuraminidase-1", Biochimica Et Biophysica Acta (Bba) - General Subjects, vol. 1790, no. 4, p. 275-282, 2009. https://doi.org/10.1016/j.bbagen.2009.01.006
[11] D. Allendorf, E. Franssen, & G. Brown, "Lipopolysaccharide activates microglia via neuraminidase 1 desialylation of toll‐like receptor 4", Journal of Neurochemistry, vol. 155, no. 4, p. 403-416, 2020. https://doi.org/10.1111/jnc.15024
[12] Q. Wang, Z. Chen, X. Peng, Z. Zheng, A. Le, J. Guoet al., "Neuraminidase 1 exacerbating aortic dissection by governing a pro-inflammatory program in macrophages", Frontiers in Cardiovascular Medicine, vol. 8, 2021. https://doi.org/10.3389/fcvm.2021.788645
[13] X. Zhou, Y. Zhai, C. Liu, G. Yang, J. Guo, G. Liet al., "Sialidase neu1 suppresses progression of human bladder cancer cells by inhibiting fibronectin-integrin α5β1 interaction and akt signaling pathway", Cell Communication and Signaling, vol. 18, no. 1, 2020. https://doi.org/10.1186/s12964-019-0500-x
[14] Y. Natori, N. Ohkura, M. Nasui, G. Atsumi, & F. Kihara-Negishi, "Acidic sialidase activity is aberrant in obese and diabetic mice", Biological and Pharmaceutical Bulletin, vol. 36, no. 6, p. 1027-1031, 2013. https://doi.org/10.1248/bpb.b12-00995

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Hello, I am taking a look at the mouse Neu1 and Neu3 recombinant proteins and I am wondering if the proteins are functional for in vitro studies and if so, under which conditions.

A:

We have no relevant testing and have not received relevant feedback from customers for the time being. What we do is the full-length or full-length mature protein, which is purified by affinity chromatography in a mild environment. In theory, it should be active.
However, its biological activity has not been detected and evaluated. Therefore we cannot guarantee 100% activity. If you are interested in the activity of this protein, you need to determine its biological activity based on your own practical experience. Maybe try it out with a small trial size first.

Target Background

Function
Catalyzes the removal of sialic acid (N-acetylneuraminic acid) moieties from glycoproteins and glycolipids. To be active, it is strictly dependent on its presence in the multienzyme complex. Appears to have a preference for alpha 2-3 and alpha 2-6 sialyl linkage.
Gene References into Functions
  1. The NEU1 exists on the cell surface of mouse thymocytes and CD5 is a natural substrate for it. PMID: 29897583
  2. Neu1 inhibits lipolysis induced by beta-adrenergic stimulation in adipocytes via interactions with Plin1 on lipid drops. PMID: 28429532
  3. Neu1 is the only lysosomal multienzyme complex gene underexpressed in mucopolysaccharidosis type I mice. PMID: 27720939
  4. Neu1 desialylation is a mechanism of Fc-independent platelet clearance in immune thrombocytopenia. PMID: 26185093
  5. Data indicate a role for neuraminidase 1 (Neu1) in regulating Siglec E protein-toll-like receptor 4 (TLR4) interaction and endotoxemia. PMID: 25187624
  6. elastin-derived peptides as an enhancer of atherogenesis and defines the Neuraminidase 1/PI3Kgamma signalling pathway as a key mediator PMID: 24357053
  7. significant increases in Col1a1, serine/threonine-protein kinase 1, Ctnnb1, CSRNP1, Ddit4, Cyp2e1, and Krit1 expressions and great decreases inreceptor D2, Neu1, and Dhcr7 expressions following long-term exposure to TiO2 NPs PMID: 23533084
  8. NEU1 deficiency has a role in determining amyloid precursor protein levels and amyloid-beta secretion via deregulated lysosomal exocytosis PMID: 24225533
  9. The activity of NEU1 was preferentially higher in epididymal fat and lower in the livers of two strains of obese and diabetic mice. PMID: 23727924
  10. these studies identify Neu1 as a novel component of the signaling pathways of energy metabolism and glucose uptake. PMID: 23520133
  11. The rescue of sialidase activity in hypomorphic sialidase mice using helper-dependent adenovirus resulted in increased VLDL production and an increase in MTP levels. PMID: 22984145
  12. Data indicate that sialidases Neu1 and Neu3 are present on sperm, and their activity is required for capacitation and zona pellucida binding. PMID: 22989879
  13. Neuraminidase 1 as a modulator of cell receptors. (Review) PMID: 21928149
  14. The deficiency of lysosomal neuraminidase may result in a serious hearing loss and morphological alterations of ear. PMID: 16408748
  15. desialylation of both IR and IGF-1R by Neu1 controls the net proliferative response of skeletal myoblasts to insulin PMID: 20100694
  16. Hyaluronan receptor activity of CD44 and acute asthmatic reactions, including Th2-mediated airway inflammation and airway hyperresponsiveness, are dependent upon Neu1 enzymatic activity. PMID: 20491786
  17. A potential role of NEU1 in cell proliferation and extracellular matrix remodeling. PMID: 20388541
  18. The neuraminidase-1 (Neu1) knockout mouse model is a phenocopy of the lysosomal storage disease sialidosis, characterized by neuropathic symptoms, including hearing loss. PMID: 19857571
  19. A membrane controlling mechanism that is initiated by ligand binding to TLR-2, -3 and-4 to induce Neu1 sialidase activity within minutes in live primary bone marrow (BM) macrophage cells and macrophage and dendritic cell lines, is showed. PMID: 19430901
  20. The cell surface Neu1 activates the phagocytosis in macrophages and dendritic cells through desialylation of surface receptors, thus, contributing to their functional integrity. PMID: 19889639
  21. Neu1 is a negative regulator of lysosomal exocytosis. PMID: 18606142
  22. in vivo histopathological effects of neuraminidase-1 (Neu1) deficiency on elastin assembly in the lungs and aorta of mice PMID: 18689602
  23. A regulatory mutation, (-519G-->A) within the neu1 promoter generates a consensus binding site for Nkx3 family transcription repressors. PMID: 19217813
  24. The N-terminal N-glycan of NEU1 is indispensable for its function, whereas the C-terminal N-glycan appears to be non-essential. The omission of the second N-glycan can be compensated for by upregulating the expression of protective protein/cathepsin A. PMID: 19714866

Show More

Hide All

Subcellular Location
Lysosome membrane; Peripheral membrane protein; Lumenal side. Lysosome lumen. Cell membrane. Cytoplasmic vesicle. Note=Localized not only on the inner side of the lysosomal membrane and in the lysosomal lumen, but also on the plasma membrane and in intracellular vesicles.
Protein Families
Glycosyl hydrolase 33 family
Tissue Specificity
Highly expressed in kidney, epididymis, followed by brain, spinal cord and weakly expressed in adrenal, heart, liver, lung and spleen.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*