Recombinant Mouse Single Ig IL-1-related receptor (Sigirr), partial

Code CSB-EP888356MO
Abbreviation Recombinant Mouse Sigirr protein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
Sigirr; Tir8; Single Ig IL-1-related receptor; Single Ig IL-1R-related molecule; Single immunoglobulin domain-containing IL1R-related protein; Toll/interleukin-1 receptor 8; TIR8
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-117aa
Target Protein Sequence
MAGVCDMAPNFLSPSEDQALGLALGREVALNCTAWVFSRPQCPQPSVQWLKDGLALGNGSHFSLHEDFWVSANFSEIVSSVLVLNLTNAEDYGTFTCSVWNVSSHSFTLWRAGPAGH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.7kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. Attenuates the recruitment of receptor-proximal signaling components to the TLR4 receptor, probably through an TIR-TIR domain interaction with TLR4. Through its extracellular domain interferes with the heterodimerization of Il1R1 and IL1RAP.
Gene References into Functions
  1. Here the authors show that hyperactivation of the interleukin 1 pathway, through either ablation of the interleukin 1 receptor 8 (IL-1R8, also known as SIGIRR or Tir8) or activation of IL-1R, leads to up-regulation of the mTOR pathway and increased levels of the epigenetic regulator MeCP2, bringing to disruption of dendritic spine morphology, synaptic plasticity and plasticity-related gene expression. PMID: 28347403
  2. Commensal flora depletion and IL-1R1 deficiency abated platelet hyperactivity and the increased platelet/neutrophil aggregation observed in Il1r8(-/-) mice in vitro and in vivo, suggesting a key role of IL-1R8 in regulating platelet TLR and IL-1R1 function PMID: 27297888
  3. Tir8/SIGIRR acts anti-inflammatory on different immune responses,its function in allergic asthma is a controversial issue, since anti- as well as pro-inflammatory effects have been reported PMID: 26561030
  4. Expression of SIGIRR(N86/102S) in the colonic epithelium of mice increases expression of inflammatory cytokines and formation and size of colitis-associated tumors. PMID: 26344057
  5. IL-37 requires IL-18Ralpha and SIGIRR/IL-1R8 to diminish allergic airway inflammation in mice PMID: 25557042
  6. IL-37 requires the receptors IL-18Ralpha and IL-1R8 to carry out its multifaceted anti-inflammatory program upon innate signal transduction. PMID: 25729923
  7. impairs the antibacterial host defense during pneumonia and sepsis caused by S. pneumoniae PMID: 24556793
  8. IL-37 acts as an extracellular cytokine by binding to the IL-18 receptor but using the IL-1R8 for its anti-inflammatory properties. PMID: 25654981
  9. Thus, SIGIRR expression by IEC reflects a strategy that sacrifices maximal innate responsiveness by IEC in order to promote commensal microbe based colonization resistance against bacterial pathogens. PMID: 23950714
  10. This study identifies TIR8/SIGIRR as a novel intrinsic negative regulator of innate IL-17A expression PMID: 23945140
  11. Absence of TIR8 reduces house dust mite-induced allergic airway inflammation in mice. PMID: 23614768
  12. data suggest that TIR8 is an important negative regulator of an LPS-mediated inflammatory response in tubular epithelial cells and dampens an effective antibacterial host response during pyelonephritis PMID: 22890991
  13. TIR8 has a nonredundant effect in modulating the inflammation caused by Pseudomonas aeruginosa, in particular, by negatively regulating IL-1RI signaling, which plays a major role in the pathogenesis of bacterial pneumonia. PMID: 22025515
  14. in the absence of TIR8 the appearance of monoclonal B-cell expansions is accelerated and mouse life span is shortened in chronic lymphocytic leukemia PMID: 21652674
  15. Data argue against a significant role of SIGIRR in renal fibrosis. PMID: 21544241
  16. These findings highlight the functional role of SIGIRR in regulating inflammatory-mediated synaptic and cognitive decline PMID: 21389242
  17. modulating the expression level of SIGIRR may be a promising potential treatment for acute lung injury. PMID: 20661180
  18. SIGIRR is expressed constitutively in intestinal epithelial cells to maintain gut innate immunity and then down-regulated during inflammation by inhibition of an SP1-mediated pathway. PMID: 21077278
  19. we set out to establish whether the absence of SIGIRR was associated with inflammatory changes in the brain PMID: 20394816
  20. Loss of single immunoglobulin interlukin-1 receptor-related molecule leads to enhanced colonic polyposis in Apc(min) mice. PMID: 20416302
  21. Our results demonstrate an important mechanism by which SIGIRR controls Th17 cell expansion and effector function through the IL-1-induced mTOR signaling pathway. PMID: 20060329
  22. regulatory functions in inflammation and Th1/Th2 cell polarization (Review) PMID: 19699681
  23. TIR8 represents a negative pathway of regulation of the IL-1 receptor/TLR system, expressed in epithelial cells and DC, crucial for tuning inflammation in the gastrointestinal tract. PMID: 14993616
  24. SIGIRR is critical in resistance to Pseudomonas aeruginosa corneal infection by down-regulating type 1 immunity and negative regulation of IL-1 and TLR4 signaling. PMID: 16785552
  25. Theses results indicate that epithelium-derived SIGIRR is critical in controlling the homeostasis and innate immune responses of the colon to enteric microflora. PMID: 17398123
  26. resident myeloid cells contribute to TLR-mediated antimicrobial immunity in the kidney, controlled by Tir8. Tir8 does not suppress TLR signaling in tubular epithelial cells, which supports their role as sensors of microbial infection in the kidney. PMID: 17495864
  27. TIR8, by negatively regulating intestinal inflammation, plays a nonredundant role in the control of the protumor activity of chronic inflammation in the gut PMID: 17616656
  28. TIR8/SIGIRR plays a key role in damping inflammation and tissue damage in M. tuberculosis infection. PMID: 17709526
  29. As a consequence of its interaction with the orphan receptor, single Ig IL-1R-related molecule (SIGIRR)/TIR8, IL-1F5 mediates anti-inflammatory effects in brain tissue. PMID: 18284608
  30. Tir8 acts as a negative regulator of the Th17 pathway in fungal infections and is essentially required to fine-tune the inflammatory and adaptive immune response to Candida albicans and Aspergillus fumigatus. PMID: 18322211
  31. lack of Sigirr enhanced the activation and proliferation of B cells, including the production of autoantibodies against multiple nuclear lupus autoantigens. These data identify Sigirr as a novel SLE susceptibility gene. PMID: 18644972
  32. SIGIRR plays an important role in the regulation of T helper (Th)2 cell response in vivo, possibly through its impact on interleukin-33-ST2-mediated signaling. PMID: 19234154
  33. SIGIRR prevents overshooting tissue injury by suppressing the postischemic activation of intrarenal myeloid cells. PMID: 19692646
  34. TIR8 acts locally as a key regulator of allogeneic immune response in the kidney; in a mouse model of kidney graft acceptance induced by costimulation blockade, most Tir8-deficient grafts are acutely rejected. PMID: 19734209

Show More

Hide All

Subcellular Location
Membrane; Single-pass type III membrane protein.
Protein Families
Interleukin-1 receptor family
Tissue Specificity
Expressed at high levels in kidney, and at moderate levels in colon, small intestine, lung, spleen and liver. Not expressed in brain and muscle. Expressed at high levels in epithelial cells, at moderate levels in splenocytes, and at low or undetectable le
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*