Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Target Names

Slc5a2

Uniprot No.

Q923I7

Research Area

Signal Transduction

Alternative Names

Low affinity sodium-glucose cotransporter;Solute carrier family 5 member 2

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

333-421aa

Target Protein Sequence

SRILYPDEVACVVPEVCKRVCGTEVGCSNIAYPRLVVKLMPNGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIYTRLRPRAGDKELL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

16.6 kDa

Protein Length

Partial

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Efficient substrate transport in mammalian kidney is provided by the concerted action of a low affinity high capacity and a high affinity low capacity Na(+)/glucose cotransporter arranged in series along kidney proximal tubules.

Gene References into Functions

By studying glucagon secretion in cultured alpha cells, a role was revealed for SGLT1 in modulating the promoter effect of Dapagliflozin (a highly selective SGLT2 inhibitor) on glucagon release. PMID: 28499695
Taken together, it was concluded that the effect of SGLT2 inhibition on weight loss is in part mediated via the liver-brain-adipose neurocircuitry. PMID: 28928093
Tofogliflozin, a selective inhibitor of sodium-glucose cotransporter 2, suppress albuminuria and tubulointerstitial injury in obese and type 2 diabetic mice. Inhibition of glucose entry into tubular cells by tofogliflozin may exert renoprotective properties in diabetes. PMID: 27407083
SGLT2 inhibition induced gluconeogenesis mainly in the kidney, whereas for low carbohydrate diet, it was predominantly in the liver. PMID: 27327650
Suggest SGLT2 inhibitor pragliflozin may be effective when administered as part of a combination regimen in the treatment of type 2 diabetes. PMID: 26450351
these results suggest that SGLT2i treatment acutely suppresses energy expenditure in BAT via regulation of an inter-organ neural network consisting of the common hepatic vagal branch and sympathetic nerves. PMID: 26963613
In conclusion, SGLT2 inhibitor luseogliflozin ameliorates glycemic control and thus exerts protective effects on pancreatic beta-cell mass and function. PMID: 26505796
SGLT2 can transport gentamicin and contribute to gentamicin-induced cytotoxicity. PMID: 25268124
SGLT2 is inhibited with dapagliflozin in pancreatic alpha cells, which triggers glucagon secretion PMID: 25894829
DNA sequencing of SGLT2 in SAMP10/TaSlc mice revealed a single nucleotide deletion of guanine at 1236, which resulted in a frameshift mutation that produced a truncated protein. PMID: 25450362
Improved glycemic control in mice lacking Sglt1 and Sglt2. PMID: 23149623
Prevention of renal glucose reabsorption by SGLT2 deletion reduced hyperglycemia, improved glucose intolerance, and increased glucose-stimulated insulin secretion in vivo. PMID: 21357472
SGLT2 mediates glucose reabsorption in the early proximal tubule and most of the glucose reabsorption by the kidney, overall. PMID: 20616166

Hide All

Subcellular Location

Membrane; Multi-pass membrane protein.

Protein Families

Sodium:solute symporter (SSF) (TC 2.A.21) family

Database Links

KEGG: mmu:246787

STRING: 10090.ENSMUSP00000112597

UniGene: Mm.38870

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP821656MO
Abbreviation	Recombinant Mouse Slc5a2 protein, partial
MSDS	MSDS Datasheet
Size	$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Sodium/glucose cotransporter 2 (Slc5a2), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage