Name: Recombinant Mouse T-cell surface glycoprotein CD3 epsilon chain(Cd3e),partial
Brand: CUSABIO
SKU: CSB-YP004931MO

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Cd3e

Uniprot No.

P22646

Research Area

Immunology

Alternative Names

Cd3eT-cell surface glycoprotein CD3 epsilon chain; T-cell surface antigen T3/Leu-4 epsilon chain; CD antigen CD3e

Species

Mus musculus (Mouse)

Source

Yeast

Expression Region

23-108aa

Target Protein Sequence

DAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVD
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

11.9 kDa

Protein Length

Extracellular Domain

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer,50% glycerol

Troubleshooting
and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Yeast-expressed T-cell surface glycoprotein CD3 epsilon chain (Cd3e) CSB-YP004931MO is a recombinant fusion protein of partial Cd3e coupled to a 6xHis-tag at the N-terminus. This protein consists of the extracellular domain (23-108aa) of mouse Cd3e and has a calculated molecular weight of 11.9 kDa. Its identity was validated by the LC-MS/MS analysis. The SDS-PAGE showed an observed Cd3e protein molecular mass of about 14.5-16 kDa. The purity of this protein is over 90%. In-stock Cd3e proteins are offered now. Except for specific antibody synthesis, this recombinant Cd3e protein also may be used in the Cd3e-related immunology studies.

Cd3e, together with CD3-gamma, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex has a vital role in coupling antigen recognition to several intracellular signal-transduction pathways. Cd3e is essential for T-cell development. Deficiencies of Cd3e lead to immunodeficiency. It is also related to the susceptibility of type I diabetes in women.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

We are interested in item CSB-YP004931MO. For the current lot, would you please tell me the buffer before the product was lyophilized? What do you recommend for reconstitution?
Would you have this information available to share?

Thanks for your email.
The stock of this protein has just run out. The new lot is already under production and we will rush the preparation.
1. This protein has been delivered in liquid form in the following two buffers before: 1) PBS, pH 7.4, 50% glycerol; 2) 20 mM Tris-HCl, 0.5 M NaCl, pH 8.0, 50% glycerol.
2. If you would like Lyophilized Powder, we will add 6% trehalose to help dissolving later. The lead time will be extended for 3 working days. You can reconstitute the lyophilized protein directly with sterile deionized water. The general reconstitution method is as follows
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.
We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. You could use it as reference.
Any more questions, feel free to contact us. Nice day.

Target Background

Function

Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition of this role of signal transduction in T-cell activation, CD3E plays an essential role in correct T-cell development. Participates also in internalization and cell surface down-regulation of TCR-CD3 complexes via endocytosis sequences present in CD3E cytosolic region.

Gene References into Functions

The data show that CD3epsilon chain couples to Cbl via simultaneous binding of both proteins to Numb, thus mediating TCR degradation PMID: 26507128
IL-17-producing CD3(bright) gammadelta T cells responded promptly and strongly to pneumococcal infection and during skin inflammation. PMID: 25385067
these results suggest that CD3zeta can be degraded by two pathways: SLAP/c-Cbl, which targets internalized cell surface CD3zeta dependent on TCR signaling, and LAPTM5, which targets intracellular CD3zeta independent of TCR signaling. PMID: 24638062
these results indicate that membrane association of the CD3epsilon signaling domain is required for optimal thymocyte development and peripheral T cell function. PMID: 24899501
These results suggest that proteasome-mediated degradation is involved in hypophosphorylated LAT and PLCgamma1 in Dow2-induced anergic T cells. The novel CD3-specific Ab, Dow2, may provide us with a unique tool for inducing immunosuppression PMID: 24595757
that Nck recruitment to the TCR is fundamental to mount an efficient T cell response in vivo, and that the Nck-CD3epsilon interaction may represent a target for pharmacological modulation of the immune response. PMID: 24470497
Structure of murine CD3epsilon complexed with the mitogenic anti-CD3epsilon antibody 2C11 enabled structural comparisons of antibody-liganded and unliganded forms of CD3epsilon revealing that antibody binding does not induce any substantial rearrangements within CD3epsilon. PMID: 22262845
CFTR dysfunction in T cells can lead directly to aberrant immune responses in CD3+ lymphocytes PMID: 20724552
analysis of the transgenic integration site in immunodeficient tgepsilon26 human CD3epsilon transgenic mice PMID: 21203507
Polymorphisms of the CD3varepsilon ectodomain exist in mice,some of which lead to amino acid substitutions which cause structural changes and affect anti-CD3 antibody binding. PMID: 20638133
the stalks of the CD3 proteins may be critical in transmitting part of the activation signal directly through the membrane. PMID: 19956738
Results suggest that generation of CD3varepsilon chain isoforms with different N-terminal sequence and pI is a general phenomenon. PMID: 19616027
We demonstrate that the intra-cytoplasmic (IC) domain of CD3epsilon plays a critical role in regulating TCR expression on DP thymocytes. PMID: 19819936
inability of Nck to bind to the CD3epsilon proline-rich sequence in thymocytes after TCR ligation PMID: 15972658
That CD43 costimulation was responsible for elevated cytokine/chemokine activity was confirmed at the transcriptional level by real-time PCR for IFN-gamma and CCL5, and by ELISA for IFN-gamma. PMID: 16246302
insulin-specific Tregs producing IL-10, TGF-beta, and IL-4 are enhanced by suppression of CD3epsilon in a mouse model of autoimmune diabetes PMID: 16628253
GRK2 is primarily involved in arresting G protein-coupled receptor signals, its interaction with CD3 epsilon may provide a novel means whereby the TCR can negatively regulate signals generated through G protein-coupled receptors. PMID: 17420248
FcgammaRIIB, a low-affinity immunoglobulin G Fc receptor, and CD3 are involved in cerebellar functions. PMID: 17502348
CD3epsilon-mediated signal transduction pathway is essential for this transformation process PMID: 17507663
mouse CD3 epsilon chains N-terminal charged residues have roles in generating isoforms modulating antigen T cell receptor-mediated signals and T cell receptor-CD3 interactions PMID: 17561508
CD3epsilon proline-rich sequence amplifies weak TCR signals by promoting synapse formation and CD3epsilon phosphorylation PMID: 18566390
have identified distinct roles for individual motifs of CD3epsilon in the preTCR-mediated differentiation and proliferation PMID: 19342663
functional role for the CD3 epsilon lipid-binding domain in T cell biology PMID: 19542373
importance of the conformational change in CD3epsilon for the activation of T cells PMID: 19671929

Hide All

Subcellular Location

Cell membrane; Single-pass type I membrane protein.

Database Links

KEGG: mmu:12501

STRING: 10090.ENSMUSP00000099896

UniGene: Mm.210361

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Code	CSB-YP004931MO
Size	US$306
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP004931MO could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Cd3e. Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP004931MO could indicate that this peptide derived from Yeast-expressed Mus musculus (Mouse) Cd3e.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse T-cell surface glycoprotein CD3 epsilon chain(Cd3e),partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

CloseMessage

×CloseMessage