Home
Protein
Recombinant Proteins
Recombinant Mouse Transmembrane protein 106B (Tmem106b), partial

Recombinant Mouse Transmembrane protein 106B (Tmem106b), partial

^{In Stock}

Code	CSB-YP023674MO
Abbreviation	Recombinant Mouse Tmem106b protein, partial
MSDS	MSDS Datasheet
Size	$368
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Tmem106b

Uniprot No.

Q80X71

Research Area

Others

Species

Mus musculus (Mouse)

Source

Yeast

Expression Region

119-275aa

Target Protein Sequence

PRSIEVKYIGVKSAYVSYDAEKRTIYLNITNTLNITNNNYYSVEVENITAQVQFSKTVIGKARLNNITNIGPLDMKQIDYTVPTVIAEEMSYMYDFCTLLSIKVHNIVLMMQVTVTTAYFGHSEQISQERYQYVDCGRNTTYQLAQSEYLNVLQPQQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

19.6 kDa

Protein Length

Partial

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant Mouse Tmem106b protein is produced by manipulating the expression of specific genes in Yeast cells. A DNA sequence encoding the Mouse Tmem106b protein (119-275aa) is fused to an expression vector and subsequently transformed into Yeast cells. The cells that successfully integrate the vector are selected and cultured to induce the expression of the desired protein. A C-terminal 6xHis tag is attached to the protein. The recombinant Mouse Tmem106b protein protein is then purified using affinity purification, achieving a purity level of over 85%, as confirmed by SDS-PAGE analysis.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Involved in dendrite morphogenesis and maintenance by regulating lysosomal trafficking via its interaction with MAP6. May act by inhibiting retrograde transport of lysosomes along dendrites. Required for dendrite branching.

Gene References into Functions

TMEM106B drives lung cancer metastasis by inducing TFEB-dependent lysosome synthesis and secretion of cathepsins. PMID: 30013069
Grn and Tmem106b genes have opposite effects on lysosomal enzyme levels, and their interaction determines the extent of neurodegeneration PMID: 28728022
Regulated intramembrane proteolysis of the frontotemporal lobar degeneration risk factor, TMEM106B, by signal peptide peptidase-like 2a (SPPL2a). PMID: 24872421

Subcellular Location

Late endosome membrane; Single-pass type II membrane protein. Lysosome membrane; Single-pass type II membrane protein. Membrane; Lipid-anchor.

Protein Families

TMEM106 family

Database Links

KEGG: mmu:71900

STRING: 10090.ENSMUSP00000031556

UniGene: Mm.27742

Promotions