Recombinant Mouse VIP peptides (Vip)

Code CSB-EP025858MO
Abbreviation Recombinant Mouse Vip protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Neuroscience
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
80-155aa
Target Protein Sequence
RHADGVFTSDYSRLLGQISAKKYLESLIGKRISSSISEDPVPIKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
15.6 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
VIP causes vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, increases glycogenolysis and relaxes the smooth muscle of trachea, stomach and gall bladder.; PHM-27 is a potent agonist of the calcitonin receptor CALCR, with similar efficacy as calcitonin. PHM also causes vasodilation.
Gene References into Functions
  1. A significant myenteric neuronal cell loss and upregulation of VIP expression were found after focal, but not global, cerebral ischaemia. PMID: 29577471
  2. Martinotti cells in layers II/III of the mouse primary somatosensory cortex are inhibited by both parvalbumin (PV)- and vasoactive intestinal polypeptide (VIP)-expressing cells. PMID: 27897179
  3. BAD phosphorylation is essential in the cytoprotective effect of vasoactive intestinal peptide on cancer stem cells. PMID: 28569785
  4. The suprachiasmatic nucleus (SCN)network consists of multiple clusters of cellular circadian rhythms that are differentially integrated by AVP and VIP signaling, depending on the postnatal period PMID: 27626074
  5. PACAP/PAC1 signaling is important for light regulated behavior, VIP/VPAC2 signaling for stable clock function and both signaling pathways may play a role in shaping diurnality versus nocturnality. PMID: 29155851
  6. The data of this study support a key role for VIP interneurons in cortical circuit development and suggest a possible contribution to pathophysiology in neurodevelopmental disorders PMID: 28817803
  7. During arousal, VIP cells rapidly and directly inhibit pyramidal neurons; VIP cells also indirectly excite these pyramidal neurons via parallel disinhibition. PMID: 28114295
  8. This study found that VIP-/- mice show a bilateral tactile hypersensitivity after spared nerve injury and a bilateral increase in neuronal activation upon innocuous tactile paw stimulation. PMID: 28359740
  9. we found that VIP inhibits NFAT nuclear translocation in primary human pulmonary artery smooth muscle cells (PASMC). Early activation of NFATc3 in IPF patients may contribute to disease progression and the increase in VIP expression could be a protective compensatory mechanism PMID: 28125639
  10. Several studies have shown that VIP(+) cells are sensitive to neuromodulation and increase their firing during locomotion, whisking, and pupil dilation and are involved in spatially specific top-down modulation, reminiscent of the effects of top-down attention, and also that attention enhances spatial resolution. Our findings provide a bridge between these studies by establishing the inhibitory circuitry that regulates th PMID: 27911754
  11. majority of GnRH neurons in male and female mice express functional VIP receptors; effects of VIP on GnRH neurons do not alter across the estrous cycle PMID: 27501185
  12. Backup mechanisms maintain PACAP/VIP-induced arterial vasodilation in PACAP-deficient mice. PMID: 28490016
  13. in cortical VIP neurons, experience-dependent gene transcription regulates visual acuity by activating the expression of IGF1, thus promoting the inhibition of disinhibitory neurons and affecting inhibition onto cortical pyramidal neurons PMID: 26958833
  14. Chronic loss of VIP in mice leads to a disruption of certain but not all immunological compartments. PMID: 25301381
  15. neuropeptides CGRP and VIP have an important role in suppressing bone resorptive activities through RANKL/OPG pathway, similar to mechanical loading. PMID: 24717410
  16. The results show in vivo a primary role for VIP chronic exposure in CFTR membrane stability and function and confirm in vitro data. PMID: 24898584
  17. VIP signaling modulates the output from the olfactory bulb to maintain circadian rhythms in the mammalian olfactory system. PMID: 24760863
  18. VIP neuropeptide-mediated cAMP-PKA signaling has an important role in hepatic homeostasis and cytoprotection in vivo PMID: 23744729
  19. Loss of the VIP gene orchestrates a panoply of pathogenic genes which are detrimental to both left and right cardiac homeostasis. PMID: 23700405
  20. Vasoactive intestinal peptide may be an essential factor for Hertwig's epithelial root sheath development. PMID: 22925217
  21. With cyclophosphamide-induced cystitis,VIP transcript expression significantly increased in the urothelium (48 h) of NGF-OE mice. PMID: 22700375
  22. Peritoneal cells isolated from VIP KO naive mice produced lower levels of proinflammatory cytokines in response to LPS in vitro. PMID: 22615845
  23. The data indicate that the intact circadian system can compensate for some of the consequences of the loss of VIP, whereas this peptide is indispensable for endogenous encoding of seasonal information. PMID: 22512278
  24. Stimulation with VIP significantly increased cyclic AMP formation in colon preparations from control but not DSS-treated mice. PMID: 21939768
  25. Data suggest that the Vip gene is not required for induction of a gene expression program linked to small bowel growth after enhancement of GLP-2 receptor signaling. PMID: 22535770
  26. VIP increased the presence of immunoregulatory cytokines. VIP also modulates Th2/Th9 and iTreg/Th1 ratios. PMID: 21445087
  27. PACAP and VIP are endogenous mediators that likely regulate immunity and immune-mediated diseases within the skin. PMID: 22531916
  28. These data support the concept that VIP influences the endogenous oxidant/antioxidant balance. One potential implication is that VIP and its analogues may be used to treat inflammatory diseases, including asthma. PMID: 22103391
  29. VIP and pituitary adenylate cyclase-activating polypeptide 38 (PACAP-38), but not secretin, stimulated rankl mRNA expression in mouse calvarial osteoblasts. VIP inhibited mRNA expressions of opg and m-csf, effects shared by PACAP-38, but not by secretin PMID: 21815197
  30. results support that decline in VIP/VPAC local levels may influence survival/apoptosis intracellular set point in NOD acinar cells and their clearance, contributing to gland homeostasis loss in a model of Sjogren's syndrome PMID: 22059987
  31. The reduced birth rate at 16-week-old NOD mice with a Th1 systemic cytokine profile involves resorption processes with a lower expression of VIP at the sites of implantation, which acts as a local inducer of pro-implantatory LIF and Treg activation. PMID: 19633131
  32. VIP blockade induces microcephaly through Mcph1 signaling; VIP/Mcph1/Chk1 signaling is key for normal cortical development PMID: 21737879
  33. absence of this peptide alters both the amplitude of circadian rhythms as well as the phase relationships between the rhythms in the suprachiasmatic nucleus and periphery PMID: 21628547
  34. Antigen-specific primary and secondary immune responses are accelerated in VIP-deficient (KO) mice and in mice reconstituted with VIP-KO hematopoietic cells, supporting the role of VIP in immune counter-regulatory pathways. PMID: 21677142
  35. the VIP/VPAC2 system induces reactive astrocytosis and plays a key role in neuroprotection against excitotoxicity in neurological disorders PMID: 21281617
  36. VIP enhancement of the severity of dextran sodium sulfate-induced colitis is mediated solely by VPAC1 receptors in mice. PMID: 21295288
  37. The results suggest that VIP has a role in the neural control of pelvic organ function and activation of VPAC and/or PACAP receptors can modulate the activity of the autonomic neurons innervating pelvic organs. PMID: 20428965
  38. Data describe PACAP, vasoactive intestinal polypeptide, and PAC1, VPAC1, VPAC2 transcripts or protein expression in urothelium and detrusor smooth muscle and lumbosacral dorsal root ganglia in NGF-overexpressing and wildtype mice. PMID: 20449688
  39. VIP provides significant protection against spontaneous diabetes by modulating T-cell subsets and counterbalancing tolerance and immunity. PMID: 20309012
  40. PACAP/VIP as well as their three classes of receptors are important in many physiological/pathophysiological processes, some of which are identified in these studies using knockout animals. PMID: 21157320
  41. These results demonstrate that VIP is an important regulator of physiological circadian rhythmicity in the heart. PMID: 20952671
  42. The study provides new insights into the local regulation of VIP in the columnar epithelia of the allergic lung. PMID: 20566347
  43. VIP plays an unanticipated permissive and/or proinflammatory role in the propagation of the inflammatory response in the CNS PMID: 20978211
  44. VIP and PACAP regulate the responsiveness of cells within the suprachiasmatic nucleus to the effects of light PMID: 20180841
  45. VIP knockout mice demonstrate elevated plasma glucose, insulin, and leptin levels, with no islet beta-cell number/topography alteration. PMID: 20150284
  46. These results confirm that TH2, but not TH1 cells, express and secrete functional VIP following specific antigen stimulation. PMID: 11935374
  47. VIP and PACAP have an anti-inflammatory role by a new mechanism associated with impairment of a key component of the chemokine network PMID: 12090758
  48. There was a deficient VIP-activated signaling associated with a reduced saliva and amylase secretion in response to VIP, suggesting impaired balance of neuroimmune interactions in reduced salivary secretion of NOD mice. PMID: 12225893
  49. VIP/PACAP interference with the p65/CBP interaction in activated microglia may represent a significant element in the regulation of the inflammatory response in the CNS by the endogenous neuropeptides PMID: 12372411
  50. This peptide regulates nerve growth factor in the embryonic mouse. PMID: 12383868

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Glucagon family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*