Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Cardiovascular
Alternative Names
Vwfvon Willebrand factor; vWF) [Cleaved into: von Willebrand antigen 2; von Willebrand antigen II)]
Species
Mus musculus (Mouse)
Expression Region
1498-1665aa
Target Protein Sequence
DVVFVLEGSDEVGEANFNKSKEFVEEVIQRMDVSPDATRISVLQYSYTVTMEYAFNGAQSKEEVLRHVREIRYQGGNRTNTGQALQYLSEHSFSPSQGDRVEAPNLVYMVTGNPASDEIKRLPGDIQVVPIGVGPHANMQELERISRPIAPIFIRDFETLPREAPDLV
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant Mouse Vwf protein is encoded by the gene of Vwf (1498-1665aa). The gene of Vwf was cloned in a system (E.coli) that supported the expression of Vwf and translation of messenger RNA. Modification of Vwf by recombinant DNA technology could lead to the expression of the target protein. The protein was fused with N-terminal 10xHis tag & C-terminal Myc tag in the production. The purity is 85% determined by SDS-PAGE.
Vwf is a protein coding gene that encodes von Willebrand factor. According to some studies, Vwf may have the following features.
Assay of vWF-cleaving proteases based on decreased collagen-binding affinity of degraded vWF. Type 1 VWD is characterized by a partial quantitative deficiency of vWF. The full-length vWF cDNA encodes a highly repetitive protein that is much larger than the mature vWF subunit. The platelet-VWF complex is the preferred substrate for ADAMTS13 under fluid shear stress. Inhibition of the VWF-collagen interaction with an anti-human VWF monoclonal antibody resulted in abolished arterial platelet thrombus formation in baboons. The phenotype of VWF survival was found in a subgroup of patients with type 1 VWD. Low VWF levels may be associated with massive bleeding, mainly due to reduced VWF synthesis and/or constitutive secretion.