Recombinant Mouse von Willebrand factor (Vwf), partial

In Stock
Code CSB-YP025960MO
Abbreviation Recombinant Mouse Vwf protein, partial
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
    The reducing (R) protein migrates as 28 kDa in SDS-PAGE may be due to glycosylation.
    Recommended Product
  • The purity of Vwf was greater than 90% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
≥ 90% as determined by SEC-HPLC.
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
Vwfvon Willebrand factor; vWF) [Cleaved into: von Willebrand antigen 2; von Willebrand antigen II)]
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
1498-1665aa
Target Protein Sequence
DVVFVLEGSDEVGEANFNKSKEFVEEVIQRMDVSPDATRISVLQYSYTVTMEYAFNGAQSKEEVLRHVREIRYQGGNRTNTGQALQYLSEHSFSPSQGDRVEAPNLVYMVTGNPASDEIKRLPGDIQVVPIGVGPHANMQELERISRPIAPIFIRDFETLPREAPDLV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.3 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse von Willebrand factor (Vwf) is produced through a yeast expression system and covers amino acids 1498 to 1665 of the protein. This partial protein comes with an N-terminal 6xHis-tag and a C-terminal Myc-tag, which makes purification and detection much more straightforward. The product shows purity greater than 85% when verified by SDS-PAGE. This level appears sufficient for reliable research applications across different experimental settings.

Von Willebrand factor represents a crucial protein in hemostasis, working as a mediator in platelet adhesion and aggregation processes after vascular injury occurs. It's an essential component of the blood coagulation pathway, helping platelets bind to damaged endothelium and stabilizing blood clot formation. Research on von Willebrand factor may be vital for understanding bleeding disorders and developing new therapeutic strategies.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the folding state and bioactivity of this recombinant mouse Vwf protein fragment are unknown and must be considered highly uncertain. VWF is a large, complex multimeric glycoprotein whose function critically depends on extensive disulfide bond formation, specific glycosylation patterns, and higher-order oligomerization. Expressing a small fragment (1498-1665aa) corresponding to a small portion of the mature subunit in a yeast system, while eukaryotic, is unlikely to replicate the complex post-translational processing and correct disulfide bonding of the native protein. The presence of tags on both termini further complicates correct folding. The high purity by SEC-HPLC (>90%) suggests a monodisperse preparation but does not confirm a natively folded, bioactive structure capable of binding its ligands (e.g., collagen, platelets via GPIb). Therefore, applications relying on specific biological interactions are speculative.

1. Antibody Development and Validation Studies

This recombinant Vwf fragment is suitable for use as an immunogen to generate antibodies specific to this region of mouse Vwf. The dual tags facilitate purification and screening. However, it is critical to understand that the antibodies generated will be against the linear epitopes of this non-native fragment. Their ability to recognize the full-length, correctly folded, and highly multimeric native VWF in mouse plasma or tissues is very low and must be rigorously validated. The purity level is adequate for immunization, but the primary utility of these antibodies will be for detecting denatured VWF (Western blot) or this specific immunogen.

2. Comparative Species Analysis and Cross-Reactivity Studies

This application is valid and well-suited for this protein. The recombinant VWF fragment can be used effectively to map species-specific linear epitopes and test the cross-reactivity of antibodies raised against human or other species' VWF. This is a valuable application for characterizing antibody specificity, as it relies on sequence comparison rather than native folding.

3. ELISA Development and Immunoassay Standardization

The dual-tagged recombinant VWF protein can be used to develop an ELISA. However, its utility is severely limited. It is suitable for developing assays to detect antibodies raised against this specific immunogen (Application 1). It is not suitable as a standard for "mouse Vwf detection and quantification" in biological samples because it is antigenically distinct from the native, full-length, multimeric VWF in plasma. An assay using this reagent would not accurately measure endogenous VWF levels.

Final Recommendation & Action Plan

The recommended course of action is to restrict the use of this recombinat VWF protein lot to Applications 1 (antibody development with the explicit goal of generating tools for linear epitopes) and 2 (comparative species analysis), which are independent of native folding. Interaction studies and the quantitative aspects of Application 3 (ELISA for native protein quantification) must be abandoned, as they will yield biologically irrelevant data. For any functional studies related to VWF (ligand binding, multimer analysis), a full-length or much larger functional domain (e.g., the A1 domain for GPIb binding) must be produced in a mammalian expression system capable of supporting the necessary complex glycosylation and disulfide bond formation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Important in the maintenance of hemostasis, it promotes adhesion of platelets to the sites of vascular injury by forming a molecular bridge between sub-endothelial collagen matrix and platelet-surface receptor complex GPIb-IX-V. Also acts as a chaperone for coagulation factor VIII, delivering it to the site of injury, stabilizing its heterodimeric structure and protecting it from premature clearance from plasma.
Gene References into Functions
  1. is synthesized in megakaryocytes and endothelial cells (ECs) and has two main roles: to carry and protect coagulation factor VIII (FVIII) from degradation by forming VWF-FVIII complex; and to mediate platelet adhesion and aggregation at sites of vascular injury. PMID: 29392565
  2. this study shows that Von Willebrand factor protects against acute CCl4-induced hepatotoxicity through phospho-p38 MAPK signaling pathway inhibition PMID: 28868583
  3. the ADAMTS13-vWF axis is partially involved in the pathophysiology of kidney ischemic reperfusion injury. PMID: 27507004
  4. Type 2N von Willebrand disease variants were associated with decreased VWF secretion and impaired factor VIII binding/stability. PMID: 28581694
  5. identify a critical role for VWF in cerebral inflammation and blood-brain barrier damage after intracerebral haemorrhage PMID: 27782211
  6. Refrigeration-induced binding of VWF to platelets facilitates their rapid clearance by inducing GPIbalpha-mediated signaling. PMID: 29097365
  7. BLOC-2 subunit HPS6 deficiency affects the tubulation and secretion of von Willebrand factor from mouse endothelial cells PMID: 27889498
  8. A novel single-domain antibody against von Willebrand factor A1 domain that interferes with VWF-platelet interactions in vivo. By using this sdAb, show that the A1 domain is pertinent to the participation of VWF in the inflammatory response. PMID: 28642239
  9. These experiments delineate an unexpected pathway in which microbiota-triggered TLR2 signaling alters the synthesis of proadhesive VWF by the liver endothelium and favors platelet integrin-dependent thrombus growth. PMID: 28572286
  10. ADAMTS13 controls vascular remodeling by modifying VWF reactivity during stroke recovery. PMID: 28428179
  11. these novel findings support the hypothesis that conformation of the VWF A domains plays a critical role in modulating macrophage-mediated clearance of VWF in vivo. PMID: 27554083
  12. results revealed localized vascular expression of FVIII and von Willebrand factor and identified lymphatic endothelial cell as a major cellular source of FVIII in extrahepatic tissues. PMID: 27207787
  13. Endothelial cell derivedVWF is the major determinant that mediates VWF-dependent ischemic stroke by promoting postischemic thrombo-inflammation. PMID: 27444201
  14. VWF deficiency reduces the progression of liver fibrosis, suggesting a mechanistic role of elevated plasma VWF levels in cirrhosis PMID: 28527913
  15. von Willebrand factor exerts beneficial effects in a mouse sepsis model via recruitment of neutrophils to inflammatory sites. PMID: 26494840
  16. Staphylococcus lugdunensis binds directly to von Willebrand factor, which proved to be vital for withstanding shear forces and for its adhesion to the vessel wall and cardiac valves. PMID: 26743845
  17. Clinical experimental cerebral malaria progression was delayed, and overall survival was significantly prolonged in VWF(-/-) mice compared with WT controls. PMID: 26511133
  18. in stable compensated heart failure mice, disruptions in endothelial vWF expression and extrusion may reduce the incidence of endocardial thrombosis PMID: 26565707
  19. VWF is expressed in a mosaic pattern in the capillaries of many vascular beds and in the aorta. Hearts of VWF-null mice demonstrate an abnormal endothelial phenotype as well as cardiac dysfunction. PMID: 26744078
  20. SNAP23 Regulates Endothelial Exocytosis of von Willebrand Factor PMID: 26266817
  21. Both platelet-VWF and plasma-VWF are required for optimal platelet-derived FVIII gene therapy for hemophilia A in the presence of inhibitors. PMID: 25955153
  22. a genetic link between EGLN1 and VWF in a constitution specific manner which could modulate thrombosis/bleeding susceptibility and outcomes of hypoxia, is reported. PMID: 26047609
  23. novel findings demonstrate a specific and critical role for the R1205 residue in modulating macrophage-mediated clearance of VWF in vivo PMID: 25690668
  24. Clearance differences between blood group O and non-blood group O individuals may therefore be related to the blood group status of the individual rather than the ABH antigen loading on VWF itself. PMID: 25650553
  25. Certain VWD-type 2B mutations relieve the need for shear stress to induce LRP1 binding. Enhanced LRP1 binding coincides with a reduced survival of VWF/p.R1306Q and VWF/p.V1316M PMID: 25728415
  26. These data suggest that whereas platelet-derived VWF does not play a crucial role in hemostasis and arterial thrombosis, it aggravates thrombo-inflammatory diseases such as stroke via a GPIb-dependent mechanism. PMID: 26209660
  27. Platelet-endothelial interactions occur in early atherosclerosis. These interactions are in part caused by endothelial von Willebrand factor large multimers, which can be reversed with exogenous ADAMTS13. PMID: 26156014
  28. Data suggest that targeting platelet receptor glycoprotein Ibalpha (GPIbalpha)-von Willebrand factor VWF-A1 binding interface may offer a therapeutic approach to reducing platelet-driven thrombosis. PMID: 25293780
  29. Absence of vWF increases hematopoiesis in long-term bone marrow cultures and has a protective effect in irradiated lungs. PMID: 24982209
  30. VWF-binding protein contributes to vascular adhesion of S aureus through 2 independent mechanisms: shear-mediated binding to VWF and activation of prothrombin to form S aureus-fibrin-platelet aggregates. PMID: 24951431
  31. a delayed and markedly reduced thrombogenic response was still evident in VWF(-/-), GPVI, and alpha2beta1 blocked animals, suggesting that alternative primary hemostatic mechanisms can partially rescue the bleeding phenotype associated with these defects. PMID: 25051961
  32. a fragment containing only approximately 20% of the VWF sequence is sufficient to support FVIII stability in vivo PMID: 24850761
  33. Expression of VWF/p.S1494C-p.A1534C in mice triggers an acute onset of thrombotic thrombocytopenic purpura. PMID: 24713928
  34. Following endothelial damage, platelet cross-linking during closure of the vessel lumen is mediated by GPIbalpha-VWF interactions. PMID: 24553181
  35. The results indicate that elevation of extracellular sodium within the physiological range raises vWF sufficiently to increase coagulability and risk of thrombosis. PMID: 24733925
  36. Galpha12 may play an important role in promoting membrane trafficking and exocytosis for basal and thrombin-induced vWF secretion, in a process involving SNAP, Galpha12/13 and Galphaq/11 PMID: 24081657
  37. Carboxyl terminus of ADAMTS13 directly inhibits platelet aggregation and ultra large von Willebrand factor string formation under flow in a free-thiol-dependent manner. PMID: 24357063
  38. VWF represents a promising target for the treatment of cutaneous inflammation, e.g., leukocytoclastic vasculitis. PMID: 23812299
  39. VWF has a role in leukocyte recruitment with chromatin decondensation by PAD4, which increases myocardial ischemia/reperfusion injury in mice PMID: 24200682
  40. Platelet aggregation, secretion, and spreading were diminished due to inhibition of integrin alphaIIbbeta3 in platelets from mice expressing a vWD-type 2B-associated vWF (vWF/p.V1316M). PMID: 24270421
  41. a new function for VWF in vivo as regulator of bloodstream thrombopoiesis PMID: 23737952
  42. VWF type 2B binds to platelets, which is a signal for clearance by macrophages, possibly contributing to thrombocytopenia PMID: 23945153
  43. VWF deficiency confers partial preservation of blood brain barrier integrity after hypoxia/reoxygenation and seizures. PMID: 23825365
  44. Compared with wild-type mice (n=6), we found less bacteria in postcapillary (60+/-6 versus 32+/-5 bacteria) and collecting venules (48+/-5 versus 18+/-4 bacteria; P<0.05) of VWF knockout mice (n=5). PMID: 23720451
  45. Hypoxia is associated with a phenotypic shift which target regulation of VWD in lung endothelial cells. PMID: 23580145
  46. These findings implicate a role for intronic splicing in mediating lineage-specific expression of vWF in the endothelium. PMID: 23529929
  47. ADAMTS13 and VWF are causally involved in myocardial ischemia/reperfusion injury. PMID: 22983446
  48. Provide new evidence for ADAMTS13 in reducing VWF-mediated acute cerebral inflammation following ischemic stroke. PMID: 22712744
  49. Endothelial cell (EC) VWF is sufficient to support hemostasis in VWF-/- mice, and VWF produced in megakaryocytes/platelets can also contribute to hemostasis in the absence of EC-derived VWF. PMID: 22642380
  50. study showed O-glycosylations are dispensable for normal VWF multimerization and biosynthesis; it appears that some O-glycosylation sites, particularly the T1255 and T1256 residues, are involved in maintenance of VWF plasma levels and are essential for normal haemostasis PMID: 22616016

Show More

Hide All

Subcellular Location
Secreted. Secreted, extracellular space, extracellular matrix.
Tissue Specificity
Plasma. Expressed in liver.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*