Recombinant Mycobacterium paratuberculosis Probable transcriptional regulatory protein MAP_1030 (MAP_1030)

In Stock
Code CSB-YP352276MLA
Abbreviation Recombinant Mycobacterium paratuberculosis MAP_1030 protein
MSDS
Size US$436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
MAP_1030
Uniprot No.
Research Area
Others
Alternative Names
MAP_1030; Probable transcriptional regulatory protein MAP_1030
Species
Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Source
Yeast
Expression Region
1-250aa
Target Protein Sequence
MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPAGNPTLYDAIQKAKKSSVPNENIERARKRGAGEEAGGADWQTITYEGYAPNGVAVLIECLTDNRNRAASEVRVAMTRNGGTMADPGSVSYLFSRKSVVTCEKNGLTEDDILAAVLDAGAEEVEDLGDSFEIICEPTDLVAVRTALQDAGIDYDSAEAGFQPSVTVPLNADGAQKVMRLVDALEDSDDVQDVWTNADIPDEILAQIEE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.8
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mycobacterium paratuberculosis Probable transcriptional regulatory protein MAP_1030 is expressed in a yeast system as a full-length protein consisting of amino acids 1-250. The protein includes an N-terminal 6xHis-tag, which makes purification and detection straightforward. SDS-PAGE analysis shows it reaches a purity level greater than 85%, making it suitable for various research applications. This product is intended for research purposes only and is not for clinical use.

MAP_1030 appears to be a transcriptional regulatory protein from Mycobacterium paratuberculosis. It likely plays a role in gene regulation, though its exact function may involve influencing the transcription of specific genes within the bacterium. Research into the function and regulation of such proteins seems crucial for understanding bacterial gene expression and regulatory mechanisms. Studies of MAP_1030 might provide insights into the complex pathways and interactions within Mycobacterium species.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, recombinant Mycobacterium paratuberculosis MAP_1030 is produced in a yeast expression system as a full-length protein (1-250aa) with an N-terminal 6xHis-tag. Yeast expression systems provide eukaryotic folding machinery capable of supporting disulfide bond formation and some post-translational modifications, which may aid in proper folding for this transcriptional regulator. The full-length nature of the protein increases the probability of correct folding. However, transcriptional regulatory proteins often require a precise three-dimensional structure for DNA-binding and functional activity, and the His-tag could potentially interfere with folding or function. Purity >85% by SDS-PAGE is determined under denaturing conditions and does not confirm native folding or bioactivity. No validation data (e.g., DNA-binding assays, circular dichroism) are provided. Therefore, while yeast expression suggests a reasonable chance of correct folding, the protein's folding status and bioactivity cannot be confirmed without experimental validation.

1. Protein-Protein Interaction Studies

Protein-protein interactions depend on native conformation; misfolding compromises binding specificity. If correctly folded, the recombinant MAP_1030 can be used in pull-down assays to identify interaction partners, as the His-tag facilitates immobilization. However, if misfolded, interaction domains may be altered, leading to non-specific binding or failure to recognize genuine biological partners, compromising the validity of regulatory network studies.

2. DNA-Protein Interaction Analysis

DNA-binding functionality requires precise folding; structural defects would render interaction studies biologically irrelevant. If properly folded, the protein can be used in EMSA or surface plasmon resonance to study DNA-binding properties. However, if misfolded, DNA-binding domains may be disrupted, resulting in invalid binding data and incorrect conclusions about transcriptional regulation.

3. Antibody Development and Validation

Antibodies can be generated against linear sequences, but conformational epitopes may be misrepresented if the protein is misfolded. This application is suitable as antibody generation primarily relies on linear epitope recognition, which is independent of folding status. The full-length protein provides comprehensive epitope coverage. However, if misfolded, antibodies may not optimally recognize conformational epitopes of the native protein in biological contexts.

4. Structural and Biophysical Characterization

Structural studies require proper folding to generate biologically relevant data. If correctly folded, the protein is suitable for structural studies like X-ray crystallography or biophysical analysis like circular dichroism. However, if misfolded, structural data would misrepresent the native protein's architecture, leading to erroneous insights into function.

5. Comparative Mycobacterial Studies

Comparative analyses require native activity and structure to ensure meaningful evolutionary insights. If functionally active and properly folded, the recombinant MAP_1030 enables valid comparative studies with orthologs from other mycobacteria. However, activity validation is essential first, as improper folding would make cross-species comparisons misleading.

Final Recommendation & Action Plan

Before employing this recombinant MAP_1030 in any functional application, it is essential to validate its folding and bioactivity through biophysical methods (e.g., circular dichroism for secondary structure, size-exclusion chromatography for oligomeric state) and functional assays (e.g., DNA-binding tests using known promoter sequences); if validation confirms proper folding and function, proceed with applications while considering potential tag interference; if misfolded, consider using tag-free protein or alternative expression systems (e.g., mycobacterial systems) for better physiological relevance; for immediate use, antibody development can proceed but validate antibodies against native protein; avoid functional studies until proper folding and bioactivity are confirmed. Always include appropriate controls (e.g., known DNA probes, interaction partners) in experiments to ensure reliability.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Subcellular Location
Cytoplasm.
Protein Families
TACO1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*