Recombinant Mycoplasma pneumoniae Cytadherence high molecular weight protein 3(hmw3),partial

Code CSB-EP690351MLW
Size
The Latest Promotion
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 85% as determined by SDS-PAGE.
Target Names hmw3
Uniprot No. Q50360
Research Area Cardiovascular
Alternative Names hmw3; MPN_452; MP389; Cytadherence high molecular weight protein 3; Accessory adhesin protein 3; Cytadherence accessory protein 3
Species Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Source E.coli
Expression Region 160-339aa
Target Protein Sequence PVVDPDATPEQQADQLFGLDPLPQAPDEYQDTTAPPAYDQTFDQATYDQQAYDQNYDPNAYYDQQAYDQSFDQQAYDQAYDANAYNTQNYDQAHDPNAYYDSQAYSDPDQASAVAPIEVAPLQPEPVAPVVEPTAVPIVESAPIVEVTPTVEPTPTPVVETAPVVEAPKVVEPTPTPVVE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 27.1 kDa
Protein Length Partial
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Component of the cytoskeleton-like structure which stabilizes the shape of the wall-less mycoplasma. This cytoskeleton-like network of accessory proteins containing HMW proteins 1 to 5 allows the proper anchoring of cytadhesin proteins in the mycoplasmal membrane at the attachment organelle. Essential for successful surface parasitism.
Subcellular Location Cell projection, attachment organelle membrane
Database Links

KEGG: mpn:MPN452

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1