Recombinant Naja atra Cytotoxin 4

Code CSB-EP355645NFG
Product Type Recombinant Protein
Size US$2466
Uniprot No. P01443
Relevance Basic protein that bind to cell membrane and depolarizes cardiomyocytes. This cytotoxin also shows lytic activities, but 2-fold more important than that of CTX-A2. It binds to the integrin alpha-V/beta-3 with a moderate affinity. Inhibits protein kinase C. It may interact with sulfatides in the cell membrane, which induces pore formation and cell internalization and is responsible for cytotoxicity in cardiomyocytes. It also may target the mitochondrial membrane and induces mitochondrial swelling and fragmentation.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Cardiotoxin A4 Short name: CTX A4 Cardiotoxin analog IV Short name: CTX IV
Species Naja atra (Chinese cobra)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence RKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN
Research Area Others
Source E.coli
Expression Region 22-81aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 22.8kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Basic protein that bind to cell membrane and depolarizes cardiomyocytes. This cytotoxin also shows lytic activities, but 2-fold more important than that of CTX-A2. It binds to the integrin alpha-V/beta-3 with a moderate affinity. Inhibits protein kinase C. It may interact with sulfatides in the cell membrane, which induces pore formation and cell internalization and is responsible for cytotoxicity in cardiomyocytes. It also may target the mitochondrial membrane and induces mitochondrial swelling and fragmentation.
Subcellular Location Secreted, Target cell membrane
Protein Families Snake three-finger toxin family, Short-chain subfamily, Type IA cytotoxin sub-subfamily
Tissue Specificity Expressed by the venom gland.

Related Products

Antibodies

Antibodies for Naja atra (Chinese cobra)

Proteins

Proteins for Naja atra (Chinese cobra)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.