Recombinant Naja kaouthia Cobra venom factor, partial

In Stock
Code CSB-EP856221NAFe0
Abbreviation Recombinant Naja kaouthia Cobra venom factor protein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Uniprot No.
Research Area
Others
Alternative Names
; Cobra venom factor; CVF; CVFk; Complement C3 homolog) [Cleaved into: Cobra venom factor alpha chain; Cobra venom factor gamma chain; Cobra venom factor beta chain]
Species
Naja kaouthia (Monocled cobra) (Naja siamensis)
Source
E.coli
Expression Region
733-984aa
Target Protein Sequence
DDNEDGFIADSDIISRSDFPKSWLWLTKDLTEEPNSQGISSKTMSFYLRDSITTWVVLAVSFTPTKGICVAEPYEIRVMKVFFIDLQMPYSVVKNEQVEIRAILHNYVNEDIYVRVELLYNPAFCSASTKGQRYRQQFPIKALSSRAVPFVIVPLEQGLHDVEIKASVQEALWSDGVRKKLKVVPEGVQKSIVTIVKLDPRAKGVGGTQLEVIKARKLDDRVPDTEIETKIIIQGDPVAQIIENSIDGSKLN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
55.4kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Cobra venom factor (CVF) is a protein found in cobra venom that functions as a complement-activating protein [1] [2] [3] [4] [5] [6]. It is structurally and functionally similar to complement component C3b [3] [5]. CVF has been used for decomplementation of serum to investigate the role of complement in various disease model systems [4]. In terms of its main functions, CVF is known to activate the complement system, leading to complement depletion [1] [4]. This protein plays a role in complement activation and complement depletion, resembling the function of C3b [3] [5]. Additionally, CVF has been shown to boost arteriogenesis in mice [7]. Furthermore, CVF is a major functional category represented in the proteome of cervical-vaginal fluid (CVF), emphasizing its significance in the immune response [8] [9].

References:
[1] C. Vogel, D. Fritzinger, W. Gorsuch, & G. Stahl, "Complement depletion with humanised cobra venom factor: efficacy in preclinical models of vascular diseases", Thrombosis and Haemostasis, vol. 113, no. 03, p. 548-552, 2015. https://doi.org/10.1160/th14-04-0300
[2] C. Vogel and D. Fritzinger, "Humanized cobra venom factor: experimental therapeutics for targeted complement activation and complement depletion", Current Pharmaceutical Design, vol. 13, no. 28, p. 2916-2926, 2007. https://doi.org/10.2174/138161207782023748
[3] K. Wong, K. Tan, N. Tan, & C. Tan, "A neurotoxic snake venom without phospholipase a2: proteomics and cross-neutralization of the venom from senegalese cobra, naja senegalensis (subgenus: uraeus)", Toxins, vol. 13, no. 1, p. 60, 2021. https://doi.org/10.3390/toxins13010060
[4] W. Gorsuch, B. Guikema, D. Fritzinger, C. Vogel, & G. Stahl, "Humanized cobra venom factor decreases myocardial ischemia–reperfusion injury", Molecular Immunology, vol. 47, no. 2-3, p. 506-510, 2009. https://doi.org/10.1016/j.molimm.2009.08.017
[5] A. Manuwar, B. Dreyer, A. Böhmert, A. Ullah, Z. Mughal, A. Akremet al., "Proteomic investigations of two pakistani naja snake venoms species unravel the venom complexity, posttranslational modifications, and presence of extracellular vesicles", Toxins, vol. 12, no. 11, p. 669, 2020. https://doi.org/10.3390/toxins12110669
[6] S. Sharma, T. Jabeen, R. Singh, R. Bredhorst, C. Vogel, & C. Betzel, "Structural studies on the cobra venom factor: isolation, purification, crystallization and preliminary crystallographic analysis", Acta Crystallographica Section D Biological Crystallography, vol. 57, no. 4, p. 596-598, 2001. https://doi.org/10.1107/s0907444901001342
[7] P. Götz, S. Azubuike-Osu, A. Braumandl, C. Arnholdt, M. Kübler, L. Richteret al., "Cobra venom factor boosts arteriogenesis in mice", International Journal of Molecular Sciences, vol. 23, no. 15, p. 8454, 2022. https://doi.org/10.3390/ijms23158454
[8] S. Dasari, L. Pereira, A. Reddy, J. Michaels, X. Lu, T. Jacobet al., "Comprehensive proteomic analysis of human cervical−vaginal fluid", Journal of Proteome Research, vol. 6, no. 4, p. 1258-1268, 2007. https://doi.org/10.1021/pr0605419
[9] Y. Kim, K. Kim, H. Oh, S. Lee, & D. Kang, "Quantitative proteomic profiling of cervicovaginal fluid from pregnant women with term and preterm birth", Proteome Science, vol. 19, no. 1, 2021. https://doi.org/10.1186/s12953-021-00171-1

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Complement-activating protein in cobra venom. It is a structural and functional analog of complement component C3b, the activated form of C3. It binds factor B (CFB), which is subsequently cleaved by factor D (CFD) to form the bimolecular complex CVF/Bb. CVF/Bb is a C3/C5 convertase that cleaves both complement components C3 and C5. Structurally, it resembles the C3b degradation product C3c, which is not able to form a C3/C5 convertase. Unlike C3b/Bb, CVF/Bb is a stable complex and completely resistant to the actions of complement regulatory factors H (CFH) and I (CFI). Therefore, CVF continuously activates complement resulting in the depletion of complement activity.
Subcellular Location
Secreted.
Protein Families
Venom complement C3 homolog family
Tissue Specificity
Expressed by the venom gland.
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*