Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
; Cobra venom factor; CVF; CVFk; Complement C3 homolog) [Cleaved into: Cobra venom factor alpha chain; Cobra venom factor gamma chain; Cobra venom factor beta chain]
Species
Naja kaouthia (Monocled cobra) (Naja siamensis)
Expression Region
733-984aa
Target Protein Sequence
DDNEDGFIADSDIISRSDFPKSWLWLTKDLTEEPNSQGISSKTMSFYLRDSITTWVVLAVSFTPTKGICVAEPYEIRVMKVFFIDLQMPYSVVKNEQVEIRAILHNYVNEDIYVRVELLYNPAFCSASTKGQRYRQQFPIKALSSRAVPFVIVPLEQGLHDVEIKASVQEALWSDGVRKKLKVVPEGVQKSIVTIVKLDPRAKGVGGTQLEVIKARKLDDRVPDTEIETKIIIQGDPVAQIIENSIDGSKLN
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The synthesis of Recombinant N.kaouthia CVF protein began with the isolation of CVF gene from the native genome. The next step was to amplify the CVF gene by inserting the CVF gene into an expression vector and then introducing the vector into the selected host cell, E.coli. Significant amounts of recombinant N.kaouthia CVF protein were produced by the host only when expression genes were added. For the purpose of protein purification, the vector contains N-terminal 6xHis-SUMO tag to the CVF DNA sequence. The purity of this protein is 90%+ determined by SDS-PAGE.
Cobra venom factor (CVF or CVFk), also known as Complement C3 homolog is a complement-activating protein in cobra venom. It can be cleaved into the three chains: cobra venom factor alpha chain, cobra venom factor gamma chain and cobra venom factor beta chain. A functional analog of CVF in human is complement component C3b (a active fragment of C3). Similar to C3b, CVF binds factor B, which is then cleaved by factor D, giving rise to the CVFBb complex that targets the same scissile bond in C3 as the authentic complement convertases C4bC2a and C3bBb.
