Code | CSB-EP304681NGSa3 |
Product Type | Recombinant Protein |
Size | US$298 |
Uniprot No. | P67875 |
Lead Time | 3-7 business days |
Relevance | This purine-specific ribonuclease cleaves 28S RNA in eukaryotic ribosomes, inhibits protein synthesis, and shows antitumor activity. |
Image | |
Storage Buffer | Tris-based buffer,50% glycerol |
Species | Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus) |
Purity | Greater than 85% as determined by SDS-PAGE. |
Sequence | ATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH |
Research Area | Signal Transduction |
Source | E.coli |
Gene Names | mitF |
Protein Names | Allergen Asp f I Allergen I/a IgE-binding ribotoxin Major allergen Asp f 1 Allergen: Asp f 1 aspF1 |
Expression Region | 28-176aa |
Tag Info | N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged |
Mol. Weight | 34.4 kDa |
Protein Description | Full Length of Mature Protein |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Still Have Questions? | Leave a Message or Start an on-line Chat |
Function | This purine-specific ribonuclease cleaves 28S RNA in eukaryotic ribosomes, inhibits protein synthesis, and shows antitumor activity. |
Subcellular Location | Secreted |
Protein Families | Ribonuclease U2 family |
Database Links |
KEGG: afm:AFUA_5G02330 |
mitF Antibodies for Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Code | Product Name | Species Reactivity | Application |
---|---|---|---|
CSB-PA304681ZA01NGS | mitF Antibody | Neosartorya fumigata | ELISA, WB (ensure identification of antigen) |
mitF Proteins for Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Code | Product Name | Source |
---|---|---|
CSB-YP304681NGS CSB-EP304681NGS CSB-BP304681NGS CSB-MP304681NGS |
Recombinant Neosartorya fumigata Ribonuclease mitogillin(mitF) | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Arabidopsis thaliana Alcohol dehydrogenase class-3(ADH2)
Express system: E.coli
Species: Arabidopsis thaliana (Mouse-ear cress)
Recombinant Mouse E3 ubiquitin-protein ligase Mdm2(Mdm2)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Rat Regenerating islet-derived protein 3-gamma(Reg3g)
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Human Melanoma-associated antigen 10(MAGEA10)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Keratin, type II cytoskeletal 1(KRT1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Pig Epididymal secretory glutathione peroxidase(GPX5)
Express system: E.coli
Species: Sus scrofa (Pig)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.