Recombinant Neosartorya fumigata Ribonuclease mitogillin(mitF)

In Stock
Code CSB-EP304681NGSa3
Product Type Recombinant Protein
Size US$2466
Uniprot No. P67875
Lead Time 3-7 business days
Relevance This purine-specific ribonuclease cleaves 28S RNA in eukaryotic ribosomes, inhibits protein synthesis, and shows antitumor activity.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence ATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH
Research Area Signal Transduction
Source E.coli
Gene Names mitF
Protein Names Allergen Asp f I Allergen I/a IgE-binding ribotoxin Major allergen Asp f 1 Allergen: Asp f 1 aspF1
Expression Region 28-176aa
Tag Info N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged
Mol. Weight 34.4 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function This purine-specific ribonuclease cleaves 28S RNA in eukaryotic ribosomes, inhibits protein synthesis, and shows antitumor activity.
Subcellular Location Secreted
Protein Families Ribonuclease U2 family
Database Links

KEGG: afm:AFUA_5G02330

Related Products

mitF Antibodies

mitF Antibodies for Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)

mitF Proteins

mitF Proteins for Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.