Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-EP304681NGSa3 |
| Product Type | Recombinant Protein |
| Size | US$2466 |
| Uniprot No. | P67875 |
| Lead Time | 3-7 business days |
| Relevance | This purine-specific ribonuclease cleaves 28S RNA in eukaryotic ribosomes, inhibits protein synthesis, and shows antitumor activity. |
| Image |
|
| Storage Buffer | Tris-based buffer，50% glycerol |
| Species | Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus) |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Sequence | ATWTCINQQLNPKTNKWEDKRLLYSQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGNGKLIKGRTPIKFGKADCDRPPKHSQNGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHQRGNQGDLRLCSH |
| Research Area | Signal Transduction |
| Source | E.coli |
| Gene Names | mitF |
| Protein Names | Allergen Asp f I Allergen I/a IgE-binding ribotoxin Major allergen Asp f 1 Allergen: Asp f 1 aspF1 |
| Expression Region | 28-176aa |
| Tag Info | N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged |
| Mol. Weight | 34.4 kDa |
| Protein Description | Full Length of Mature Protein |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | This purine-specific ribonuclease cleaves 28S RNA in eukaryotic ribosomes, inhibits protein synthesis, and shows antitumor activity. |
| Subcellular Location | Secreted |
| Protein Families | Ribonuclease U2 family |
| Database Links |
KEGG: afm:AFUA_5G02330 |
mitF Antibodies for Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA304681ZA01NGS | mitF Antibody | Neosartorya fumigata | ELISA, WB (ensure identification of antigen) |
mitF Proteins for Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP304681NGS CSB-EP304681NGS CSB-BP304681NGS CSB-MP304681NGS |
Recombinant Neosartorya fumigata Ribonuclease mitogillin(mitF) | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Human Endothelin-1 receptor(EDNRA)
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Recombinant Mouse Muellerian-inhibiting factor(Amh) ,partial
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Human Nuclear receptor subfamily 4 group A member 2(NR4A2)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Oxytocin-neurophysin 1(OXT),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Rat Kinesin-like protein KIF1C(Kif1c)
Express system: E.coli
Species: Rattus norvegicus (Rat)
Recombinant Rat Suppressor of cytokine signaling 3(Socs3)
Express system: Yeast
Species: Rattus norvegicus (Rat)
Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 4(CEACAM4),partial
Express system: E.coli
Species: Homo sapiens (Human)
