Recombinant Plasmodium falciparum Gametocyte surface protein P230 (PFS230), partial

In Stock
Code CSB-EP302412EWP
Abbreviation Recombinant Plasmodium falciparum PFS230 protein, partial
MSDS
Size $554
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
PFS230
Uniprot No.
Research Area
Others
Species
Plasmodium falciparum (isolate 3D7)
Source
E.coli
Expression Region
2980-3116aa
Target Protein Sequence
YKEIHGCDFTGKYSHLFTYSKKPLPNDDDICNVTIGNNTFSGFACLSHFELKPNNCFSSVYDYNEANKVKKLFDLSTKVELDHIKQNTSGYTLSYIIFNKESTKLKFSCTCSSNYSNYTIRITFDPNYIIPEPQSRA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
15.9 kDa
Protein Length
Partial
Tag Info
Tag-Free
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Plasmodium falciparum (isolate 3D7) PFS230 was expressed with the amino acid range of 2980-3116. The expected molecular weight for the PFS230 protein is calculated to be 15.9 kDa. This protein is generated in a e.coli-based system. The PFS230 coding gene included the Tag-Free, which simplifies the detection and purification processes of the recombinant PFS230 protein in following stages of expression and purification.

The Plasmodium falciparum Gametocyte surface protein P230 (PFS230) is a crucial protein associated with the sexual stage of the malaria parasite's life cycle. Expressed on the surface of male and female gametocytes, PFS230 plays a vital role in the development and transmission of the parasite between the human host and the mosquito vector. PFS230 is involved in the formation of male and female gametes and subsequent fertilization within the mosquito midgut. Understanding the function of PFS230 is essential for developing interventions to disrupt the transmission of malaria, as targeting proteins involved in the sexual stages of the parasite's life cycle could potentially prevent its spread in the population.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Gametocyte surface protein required for male/female gamete fusion. Also required for male gamete exflagellation and interaction with erythrocytes.
Gene References into Functions
  1. the identification, biochemical, biophysical, and immunological characterization of recombinant Pfs230 domains. PMID: 27432885
  2. Data show that anti-Pfs230 and Pf48/45 antibodies developed rapidly after exposure to gametocytes and were strongly associated with transmission-reducing activity. PMID: 21124765
  3. These results suggest that Pfs230 is the surface molecule on males that mediates RBC binding and plays an important role in oocyst development, a critical step in malaria transmission. PMID: 16879650
Subcellular Location
Cell surface. Cell membrane.
Database Links

KEGG: pfa:PFB0405w

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*