Recombinant Bacillus anthracis Protective antigen (pagA), partial

Code CSB-YP320223BQE(A4)
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP320223BQE(A4)
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP320223BQE(A4)-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP320223BQE(A4)
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP320223BQE(A4)
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
pagA
Uniprot No.
Alternative Names
pagA; pag; pXO1-110; BXA0164; GBAA_pXO1_0164Protective antigen; PA; Anthrax toxins translocating protein; PA-83; PA83) [Cleaved into: Protective antigen PA-20; PA20); Protective antigen PA-63; PA63)]
Species
Bacillus anthracis
Expression Region
30-196
Target Protein Sequence
EVKQENRLLNESESSSQGLLGYYFSDLNFQAPMVVTSSTTGDLSIPSSELENIPSENQYF QSAIWSGFIKVKKSDEYTFATSADNHVTMWVDDQEVINKASNSNKIRLEKGRLYQIKIQY QRENPTEKGLDFKLYWTDSQNKKEVISSDNLQLPELKQKSSNSRKKR
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Protective antigen constitutes one of the three proteins composing the anthrax toxin; it mediates attachment to host cells and translocation of edema factor (EF) and lethal factor (LF) into the host cytoplasm. PA associated with LF forms the lethal toxin (LeTx) and causes death when injected; PA associated with EF forms the edema toxin (EdTx) and produces edema. PA induces immunity to infection with anthrax.; Mediates the attachment to host cells by binding host cell receptors ANTXR1 and ANTXR2. Following host cell surface attachment, PA is cleaved by FURIN to generate the PA-63 (Protective antigen PA-63) form, which constitutes the mature form of the protein that oligomerizes and forms a pore to translocate the enzymatic toxin components edema factor (EF) and lethal factor (LF) into the host cytosol.; Mature form that oligomerizes and forms a pore to translocate the enzymatic toxin components edema factor (EF) and lethal factor (LF) into the host cytosol. Following attachment to host cell receptors and cleavage by FURIN, homooligomerizes to form ring-shaped oligomers that are in a pre-pore conformation, and associates with EF and LF. Toxin-leaded complexes are then endocytosed in a clathrin-dependent process, followed by a conformational change of oligomerized PA-63 from the pre-pore to pore state, which is triggered by the low pH in the endosome. Once active, the pore mediates unfolding of EF and LF, which pass through the pore and translocate into the host cytosol.
Gene References into Functions
  1. PA is a calcium-dependent serine protease and that the protein potentially uses this proteolytic activity for receptor binding. PMID: 30052476
  2. Stability of domain 4 of the anthrax toxin protective antigen and the effect of the VWA domain of CMG2 on stability PMID: 27874231
  3. Data show that both mutant and native protective antigen vaccine preparations protected rabbits from lethal, aerosolized, spore challenge. PMID: 26207820
  4. Data suggest that anthrax protective antigen (PA) expressing Semliki Forest virus (SFV) replicon DNA or viral replicon particles (VRP) vaccines may be suitable as candidate vaccines against anthrax. PMID: 25102364
  5. N435C mutantion of anthrax protective antigen conferred dominant-negative inhibitory activity. PMID: 20213183
  6. analysis of linear epitopes in Bacillus anthracis protective antigen bound by neutralizing antibodies PMID: 19617628

Show More

Hide All

Subcellular Location
[Protective antigen]: Secreted. Host cell membrane.; [Protective antigen PA-63]: Host cell membrane; Multi-pass membrane protein. Host endosome membrane; Multi-pass membrane protein.
Protein Families
Bacterial binary toxin family
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×