Recombinant Pseudomonas aeruginosa PA-I galactophilic lectin (lecA)

In Stock
Code CSB-EP313124EZX
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP313124EZX could indicate that this peptide derived from E.coli-expressed Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) lecA.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP313124EZX could indicate that this peptide derived from E.coli-expressed Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) lecA.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
lecA
Uniprot No.
Research Area
Others
Alternative Names
lecA; pa1L; PA2570; PA-I galactophilic lectin; PA-IL; Galactose-binding lectin
Species
Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)
Source
E.coli
Expression Region
2-122aa
Target Protein Sequence
AWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
16.8kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Pseudomonas aeruginosa lecA protein is a fusion protein consists of the Pseudomonas aeruginosa lecA protein (2-122aa) partnered with the N-terminal 6xHis tag. It was produced in the E.coli. This recombinant lecA protein's purity is greater than 90% determined by SDS-PAGE. After electrophoresis, there is a 16 kDa protein band presented on the gel.

LecA is a cytotoxic lectin and adhesin produced by Pseudomonas aeruginosa which binds hydrophobic galactosides with high specificity and affinity. Certain research showed that lecA is expressed in biofilm-grown cells. The carbohydrate-binding protein LecA from Pseudomonas aeruginosa plays an important role in the formation of biofilms in chronic infections. Development of inhibitors to disrupt LecA-mediated biofilms is desired but it is limited to carbohydrate-based ligands. Moreover, discovery of drug-like ligands for LecA is challenging because of its weak affinities. Lectins are carbohydrate-binding proteins with diverse functions that are found in all domains of life. Lectins are involved in the infection process of the Gram-negative bacterium Pseudomonas aeruginosa, an important member of the often highly drug-resistant ESKAPE pathogens. The two bacterial lectins LecA and LecB, are virulence factors that are important for bacterial adhesion. LecA and LecB, which can be specific for galactose and fucose (Fuc), respectively. The affinity of Fuc and LecB was much higher than that of galactose and LecA. Multiple saccharin and saccharide inhibitors targeting LecB have successfully applied to treat P. aeruginosa infection.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
D-galactose specific lectin. Binds in decreasing order of affinity: melibiose, methyl-alpha-D-galactoside, D-galactose, methyl-beta-D-galactoside, N-acetyl-D-galactosamine. Similar to plant lectins in its selective (carbohydrate-specific) hemagglutinating activity.
Gene References into Functions
  1. The crystal structure of LecA/melibiose complex shows a secondary sugar binding site with glucose bound. PMID: 24123124
  2. Study established the structural features of PA-IL (LecA} in complex with the three disaccharides by docking and molecular dynamics simulations. PMID: 20410292
  3. It is concluded that the carbohydrate recognizing site of the lectin can have a binding requirement of only one saccharide. PMID: 16542817
  4. Results describe the crystal structure of P. aeruginosa lectin I complexed to alphaGal1-3betaGal1-4Glc trisaccharide at 1.9-A resolution and reveal how the second galactose residue makes specific contacts with the protein surface. PMID: 18762193
  5. The results demonstrate that there is a relationship between the LecA and LecB lectins and the pathogenicity of P. aeruginosa. PMID: 19237519

Show More

Hide All

Subcellular Location
Cytoplasm. Periplasm. Cell surface. Note=Low exposure on the cell surface.
Protein Families
LecA/PllA lectin family
Database Links

KEGG: pae:PA2570

STRING: 208964.PA2570

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*