Recombinant Pseudomonas putida Metapyrocatechase (xylE)

In Stock
Code CSB-EP356892FFZ
Abbreviation Recombinant Pseudomonas putida xylE protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
xylE
Uniprot No.
Research Area
others
Alternative Names
xylE; Metapyrocatechase; MPC; EC 1.13.11.2; CatO2ase; Catechol 2,3-dioxygenase
Species
Pseudomonas putida (Arthrobacter siderocapsulatus)
Source
E.coli
Expression Region
1-307aa
Target Protein Sequence
MNKGVMRPGHVQLRVLDMSKALEHYVELLGLIEMDRDDQGRVYLKAWTEVDKFSLVLREADEPGMDFMGFKVVDEDALRQLERDLMAYGCAVEQLPAGELNSCGRRVRFQAPSGHHFELYADKEYTGKWGLNDVNPEAWPRDLKGMAAVRFDHALMYGDELPATYDLFTKVLGFYLAEQVLDENGTRVAQFLSLSTKAHDVAFIHHPEKGRLHHVSFHLETWEDLLRAADLISMTDTSIDIGPTRHGLTHGKTIYFFDPSGNRNEVFCGGDYNYPDHKPVTWTTDQLGKAIFYHDRILNERFMTVLT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
55.2kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Pseudomonas putida Metapyrocatechase (xylE) represents a full-length protein expressed in E. coli, spanning 1-307 amino acids. The protein carries an N-terminal 10xHis-SUMO tag and a C-terminal Myc tag, which appear to simplify purification and detection processes. SDS-PAGE analysis suggests purity levels exceeding 90%, making it potentially suitable for research applications that demand high-quality protein preparations.

Metapyrocatechase functions as an enzyme in aromatic compound breakdown. It seems to play an important role in catechol's catabolic pathway. The enzyme catalyzes the oxidative cleavage of catechol to 2-hydroxymuconic semialdehyde, which may prove fundamental for bioremediation studies and research examining how microbes degrade environmental pollutants.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Pseudomonas putida Metapyrocatechase (xylE) is a bacterial catechol 2,3-dioxygenase that requires precise folding and iron coordination for its enzymatic activity. The E. coli expression system is generally compatible with bacterial proteins, increasing the likelihood of correct folding. However, the dual N-terminal His-SUMO tag (∼20 kDa) and C-terminal Myc tag may sterically interfere with the enzyme's active site or oligomerization. While the full-length protein (1-307aa) contains all functional domains, the large tags may compromise substrate access and catalytic activity. The probability of correct folding is moderate, but functional activity requires experimental validation due to potential tag interference.

1. Protein-Protein Interaction Studies Using Dual-Tag System

Protein-protein interactions require a precise tertiary structure that may be compromised by the large dual tags. Results should be considered preliminary without confirmation using a natively folded protein. The large N-terminal SUMO tag and C-terminal Myc tag may sterically block interaction interfaces or cause misfolding, leading to non-specific binding or failure to identify genuine partners. If correctly folded, it could reveal physiological interactions, but results require validation with tag-free protein. The dual tags do provide technical flexibility for orthogonal validation methods.

2. Antibody Development and Validation Platform

This recombinant xylE serves as an excellent immunogen for generating antibodies against Pseudomonas putida metapyrocatechase. The full-length sequence ensures comprehensive coverage of the epitope. The dual tags provide additional epitopes for screening and controls for specificity testing. These antibodies will be valuable for detecting xylE in bacterial samples and environmental studies.

3. Biochemical Characterization and Enzyme Kinetics Studies

This is the critical first step to assess protein quality and activity. Techniques like size-exclusion chromatography with multi-angle light scattering (SEC-MALS) can determine oligomeric state, while enzymatic assays with catechol substrates can validate dioxygenase activity. However, the tags may sterically hinder substrate access to the active site, potentially yielding false-negative results in activity assays. These analyses are essential but must include activity validation to confirm functional integrity despite the tags. The high purity supports reliable biochemical measurements.

4. Tag-Assisted Protein Purification Method Development

This protein is ideal for developing and optimizing multi-step purification protocols. The dual-tag system allows testing of sequential purification strategies, tag cleavage efficiency, and comparison of different chromatography methods. This application focuses on the tags rather than the protein's biological function.

Final Recommendation & Action Plan

This dual-tagged recombinant xylE is reliable for antibody development and purification optimization but requires rigorous activity validation before functional studies due to potential tag interference. The immediate priority is Application 3 (Biochemical Characterization) to test enzymatic activity with catechol substrates and assess oligomeric state via SEC-MALS. If activity is confirmed despite the tags, proceed cautiously with Application 1 (Interaction Studies). Applications 2 and 4 (Antibody Development and Purification Optimization) can proceed immediately. For reliable structural or detailed functional studies, consider tag removal or the use of tag-free xylE. This systematic approach ensures appropriate use based on functional validation, with the understanding that the tags may limit biological applications but are advantageous for technical development purposes.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*