Recombinant Putative serine/threonine-protein kinase C05D10.2 (C05D10.2)

Code CSB-YP606129CXY
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP606129CXY
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP606129CXY-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP606129CXY
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP606129CXY
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
mapk-15
Uniprot No.
Alternative Names
mapk-15; swip-13; C05D10.2Mitogen-activated protein kinase 15; EC 2.7.11.24; Swimming-induced paralysis protein 13; SWIP-13
Species
Caenorhabditis elegans
Expression Region
1-470
Target Protein Sequence
MTDDVDTHIHEKFDLQKRLGKGAYGIVWKAYDKRSRETVALKKIFDAFRNPTDSQRTFRE VMFLQEFGKHPNVIKLYNIFRADNDRDIYLAFEFMEADLHNVIKKGSILKDVHKQYIMCQ LFRAIRFLHSGNVLHRDLKPSNVLLDADCRVKLADFGLARSLSSLEDYPEGQKMPDLTEY VATRWYRSPEILLAAKRYTKGVDMWSLGCILAEMLIGRALFPGSSTINQIERIMNTIAKP SRADIASIGSHYAASVLEKMPQRPRKPLDLIITQSQTAAIDMVQRLLIFAPQKRLTVEQC LVHPYVVQFHNPSEEPVLNYEVYPPLPDHIQLSIDDYRDRLYEMIDEKKASFKRIQHEKI RPYGEDKSRAPIAQAECSDTDYDTARSLQRTTSMDKNNSSSHDSSSGTLRERAASAESRT SKDSNGEMRNGNGNTPSSIKQRRRSVERARLFANIKPSKILHPHKLISNY
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Atypical MAPK protein. Regulates primary cilium formation in sensory neurons and the localization of ciliary proteins involved in cilium structure, transport, and signaling. Acts in dopamine (DA) neurons to support synaptic membrane dat-1 availability via activation of rho-1 thereby sustaining normal levels of DA clearance. Plays a role in male mating behavior, probably in part through regulating the localization of the polycystin pkd-2. Functions postembryonically in the URX sensory neurons to constrain URX dendrite growth throughout lifetime, probably by restricting expansion of the subcellular sensory compartment at the dendrite ending.
Gene References into Functions
  1. Our results describe a primary cilia-related role for this poorly studied member of the MAPK family in vivo, and indicate a broad requirement for MAPK15 in the formation of multiple ciliary classes across species. PMID: 29021280
  2. MAPK-15 is a ciliary protein required for PKD-2 localization and male mating behavior in Caenorhabditis elegans PMID: 28745435
Subcellular Location
Cell projection, dendrite.; [Isoform a]: Perikaryon. Cell projection, dendrite. Cell projection, cilium. Cell projection, cilium membrane. Cytoplasm, cytoskeleton, cilium axoneme. Cytoplasm, cytoskeleton, cilium basal body. Cell junction.; [Isoform c]: Perikaryon. Cell projection, dendrite. Cell projection, cilium. Cell projection, cilium membrane. Cytoplasm, cytoskeleton, cilium axoneme. Cytoplasm, cytoskeleton, cilium basal body. Cell junction.
Protein Families
Protein kinase superfamily, CMGC Ser/Thr protein kinase family, MAP kinase subfamily
Tissue Specificity
Expressed in the URX neuron and in many other head sensory neurons. Isoform a: Expressed in head and tail ciliated sensory neurons, and in mid-body neurons. Isoform c: Expressed in head and tail ciliated sensory neurons, and in mid-body neurons.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×