Recombinant Entamoeba histolytica Pyruvate, phosphate dikinase (PPDK), partial

In Stock
Code CSB-EP336270EKM
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
PPDK
Uniprot No.
Research Area
Others
Alternative Names
PPDK; Pyruvate; phosphate dikinase; EC 2.7.9.1; Pyruvate; orthophosphate dikinase
Species
Entamoeba histolytica
Source
E.coli
Expression Region
1-342aa
Target Protein Sequence
MQRVYAFEDGDGTNKKLLGGKGAGLCTMTKIGLPVPQGFVITTEMCKQFIANGNKMPEGLMEEVKKEYQLVEKKSGKVFGGEENPLLVSVRSGAAMSMPGMMDTILNLGLNDKTVVALAKLTNNERFAYDSYRRFVSLFGKIALNACDEVYDKTLENKKVEKGVKLDTELDANDMKELAQVFIKKTEEFTKQPFPVDPYAQLEFAICAVFRSWMGKRAVDYRREFKITPEQADGTAVSVVSMVYGNMGNDSATGVCFTRDPGTGENMFFGEYLKNAQGEDVVAGIRTPQIISKMAEDRDLPGCYEQLLDIRKKLEGYFHEVQDFEFTIERKKLYMLQTRNGK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
54.4kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

CUSABIO transfected the expression vector which inserted the recombinant DNA into the E.coli, cultured the cells, and then induced the transcription and translation of the cloned vector. The N-terminal 6xHis-SUMO tag sequence was appended to the gene coding for the E.coli of the Entamoeba histolytica PPDK protein to form the recombinant DNA. The recombinant Entamoeba histolytica PPDK was expressed as N-terminal 6xHis-SUMO-tagged fusion. The purity of the protein is greater than 90% assayed by SDS-PAGE. It has an apparent molecular weight of approximately 55 kDa.

PPDK is known for its role in C4 photosynthesis but has no established function in C3 plants. Cytosolic PPDK isoforms are generally expressed in non-photosynthetic organs of C3 and C4 plants. Some studies have shown that cyto-solic PPDK isinvolved in a metabolic response to water deficit and low-oxygen stress in rice,an anoxia-tolerant species. As a critical enzyme for C4 photosynthesis, PPDK provides the primary acceptor for fixation of bicarbonate in mesophyll cells. Although first isolated in C4 plants, it is also present in C3 species. Studies suggested that PPDK may be important in supplying PEP to gluconeogenesis, and in ageing leaves it allows remobilisation of nitrogen to supply reproductive tissue.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the reversible phosphorylation of pyruvate and phosphate. In E.histolytica and C.symbiosus, PPDK functions in the direction of ATP synthesis.
Protein Families
PEP-utilizing enzyme family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*