Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
PPDK; Pyruvate; phosphate dikinase; EC 2.7.9.1; Pyruvate; orthophosphate dikinase
Species
Entamoeba histolytica
Expression Region
1-342aa
Target Protein Sequence
MQRVYAFEDGDGTNKKLLGGKGAGLCTMTKIGLPVPQGFVITTEMCKQFIANGNKMPEGLMEEVKKEYQLVEKKSGKVFGGEENPLLVSVRSGAAMSMPGMMDTILNLGLNDKTVVALAKLTNNERFAYDSYRRFVSLFGKIALNACDEVYDKTLENKKVEKGVKLDTELDANDMKELAQVFIKKTEEFTKQPFPVDPYAQLEFAICAVFRSWMGKRAVDYRREFKITPEQADGTAVSVVSMVYGNMGNDSATGVCFTRDPGTGENMFFGEYLKNAQGEDVVAGIRTPQIISKMAEDRDLPGCYEQLLDIRKKLEGYFHEVQDFEFTIERKKLYMLQTRNGK
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
CUSABIO transfected the expression vector which inserted the recombinant DNA into the E.coli, cultured the cells, and then induced the transcription and translation of the cloned vector. The N-terminal 6xHis-SUMO tag sequence was appended to the gene coding for the E.coli of the Entamoeba histolytica PPDK protein to form the recombinant DNA. The recombinant Entamoeba histolytica PPDK was expressed as N-terminal 6xHis-SUMO-tagged fusion. The purity of the protein is greater than 90% assayed by SDS-PAGE. It has an apparent molecular weight of approximately 55 kDa.
PPDK is known for its role in C4 photosynthesis but has no established function in C3 plants. Cytosolic PPDK isoforms are generally expressed in non-photosynthetic organs of C3 and C4 plants. Some studies have shown that cyto-solic PPDK isinvolved in a metabolic response to water deficit and low-oxygen stress in rice,an anoxia-tolerant species. As a critical enzyme for C4 photosynthesis, PPDK provides the primary acceptor for fixation of bicarbonate in mesophyll cells. Although first isolated in C4 plants, it is also present in C3 species. Studies suggested that PPDK may be important in supplying PEP to gluconeogenesis, and in ageing leaves it allows remobilisation of nitrogen to supply reproductive tissue.