Name: Recombinant Rat FAD-linked sulfhydryl oxidase ALR(Gfer)
Brand: CUSABIO
SKU: CSB-EP733907RA

Product Details

Purity	Greater than 90% as determined by SDS-PAGE.
Target Names	Gfer
Uniprot No.	Q63042
Research Area	Signal Transduction
Alternative Names	Gfer; AlrFAD-linked sulfhydryl oxidase ALR; EC 1.8.3.2; Augmenter of liver regeneration
Species	Rattus norvegicus (Rat)
Source	E.coli
Expression Region	1-198aa
Target Protein Sequence	MAAPSEPAGFPRGSRFSFLPGGAHSEMTDDLVTDARGRGARHRKDNAPAAAPAPKGLEHGKRPCRACVDFKSWMRTQQKRDIKFREDCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSCD Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight	38.8kDa
Protein Length	Full Length
Tag Info	N-terminal 6xHis-SUMO-tagged
Form	Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	3-7 business days
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA	Please contact us to get it.

Target Background

Function	FAD-dependent sulfhydryl oxidase that regenerates the redox-active disulfide bonds in CHCHD4/MIA40, a chaperone essential for disulfide bond formation and protein folding in the mitochondrial intermembrane space. The reduced form of CHCHD4/MIA40 forms a transient intermolecular disulfide bridge with GFER/ERV1, resulting in regeneration of the essential disulfide bonds in CHCHD4/MIA40, while GFER/ERV1 becomes re-oxidized by donating electrons to cytochrome c or molecular oxygen. May have a function in liver regeneration and spermatogenesis.
Gene References into Functions	our results demonstrate that Growth Factor Erv1-Like gene knock-down, i.e., the lack of Augmenter of Liver Regeneration, modifies the expression of genes involved in cell apoptosis and inhibits early phase of DNA synthesis. PMID: 24880092 improves hepatocyte survival and promoted liver recovery after transplantation for acute liver failure PMID: 23337881 ALR may serve as a potential diagnostic marker of hepatocellular stress and/or acute inflammatory conditions. PMID: 23073658 ALR level in serum may indicate hepatocyte proliferation or liver regeneration. High ALR level in serum in early stage of acute-on-chrinic liver failure may mean a good prognosis. PMID: 22246190 Loss of augmenter of liver regeneration is associated with renal dysfunction in ischaemia/reperfusion injury. PMID: 20332418 effectively accelerates kidney recovery after acute renal failure induced by gentamicin; the protective effect is associated with enhanced proliferation of renal tubular cells PMID: 20030531 crystal structure of ALR has been determined to 1.8 A, and possible physiological roles of ALR are examined PMID: 12717032 Data show that augmenter of liver regeneration factor (ALR) can promote hepatocyte proliferation induced by Kupffer cells, suggesting that Kupffer cells play a dual role in liver regeneration. PMID: 16937468 review of the molecular biology of ALR [review] PMID: 16937489 Demonstrate that Alrp improves SH-SY5Y cells survival in H(2)O(2)-induced apoptosis. PMID: 19629817 Demonstrate specific G-protein coupled binding of ALR and its function in Kupffer cells and suggest that mediators produced by ALR-stimulated Kupffer cells may elicit physiologically important effects on hepatocytes. PMID: 19859909 Show More Hide All
Subcellular Location	Mitochondrion intermembrane space. Mitochondrion.
Database Links	KEGG: rno:27100 STRING: 10116.ENSRNOP00000017917 UniGene: Rn.11039

CloseMessage

Product >> Product Name：
Product >> Code：
Product >> Size：
Name： *
Email： *
Phone：
We recommend you to leave your phone number because occasionally our emails get flagged by spam filters. We would not disclose any of your private information to any third party.
Question/Comment： *
Your Region： *
Country State：
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
Check Code：

Code	CSB-EP733907RA
Size	US$2466
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Rat FAD-linked sulfhydryl oxidase ALR(Gfer)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

CloseMessage

×CloseMessage