Recombinant Rat FAD-linked sulfhydryl oxidase ALR (Gfer)

In Stock
Code CSB-EP733907RA
Abbreviation Recombinant Rat Gfer protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Gfer; AlrFAD-linked sulfhydryl oxidase ALR; EC 1.8.3.2; Augmenter of liver regeneration
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
1-198aa
Target Protein Sequence
MAAPSEPAGFPRGSRFSFLPGGAHSEMTDDLVTDARGRGARHRKDNAPAAAPAPKGLEHGKRPCRACVDFKSWMRTQQKRDIKFREDCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSCD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
38.8kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Introducing our Recombinant Rat FAD-linked sulfhydryl oxidase ALR, a product that is pivotal to the field of Signal Transduction research. Also known as Augmenter of Liver Regeneration, this protein is crucial for cell growth and liver regeneration. It is encoded by the 'Gfer' (also known as Alr) gene in the Rat species and plays a fundamental role in many intracellular processes such as cellular antioxidant defense systems.

This protein, produced in E.coli, is full length, spanning from amino acid 1 to 198. It comes with an N-terminal 6xHis-SUMO tag, facilitating easy detection and purification. You can rest assured of its quality, as we verify its purity to be greater than 90% as determined by SDS-PAGE. You have the flexibility to choose whether you would prefer it in liquid form or as lyophilized powder. With our Recombinant Rat Gfer, you can expect precise results in your research.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
FAD-dependent sulfhydryl oxidase that regenerates the redox-active disulfide bonds in CHCHD4/MIA40, a chaperone essential for disulfide bond formation and protein folding in the mitochondrial intermembrane space. The reduced form of CHCHD4/MIA40 forms a transient intermolecular disulfide bridge with GFER/ERV1, resulting in regeneration of the essential disulfide bonds in CHCHD4/MIA40, while GFER/ERV1 becomes re-oxidized by donating electrons to cytochrome c or molecular oxygen. May have a function in liver regeneration and spermatogenesis.
Gene References into Functions
  1. our results demonstrate that Growth Factor Erv1-Like gene knock-down, i.e., the lack of Augmenter of Liver Regeneration, modifies the expression of genes involved in cell apoptosis and inhibits early phase of DNA synthesis. PMID: 24880092
  2. improves hepatocyte survival and promoted liver recovery after transplantation for acute liver failure PMID: 23337881
  3. ALR may serve as a potential diagnostic marker of hepatocellular stress and/or acute inflammatory conditions. PMID: 23073658
  4. ALR level in serum may indicate hepatocyte proliferation or liver regeneration. High ALR level in serum in early stage of acute-on-chrinic liver failure may mean a good prognosis. PMID: 22246190
  5. Loss of augmenter of liver regeneration is associated with renal dysfunction in ischaemia/reperfusion injury. PMID: 20332418
  6. effectively accelerates kidney recovery after acute renal failure induced by gentamicin; the protective effect is associated with enhanced proliferation of renal tubular cells PMID: 20030531
  7. crystal structure of ALR has been determined to 1.8 A, and possible physiological roles of ALR are examined PMID: 12717032
  8. Data show that augmenter of liver regeneration factor (ALR) can promote hepatocyte proliferation induced by Kupffer cells, suggesting that Kupffer cells play a dual role in liver regeneration. PMID: 16937468
  9. review of the molecular biology of ALR [review] PMID: 16937489
  10. Demonstrate that Alrp improves SH-SY5Y cells survival in H(2)O(2)-induced apoptosis. PMID: 19629817
  11. Demonstrate specific G-protein coupled binding of ALR and its function in Kupffer cells and suggest that mediators produced by ALR-stimulated Kupffer cells may elicit physiologically important effects on hepatocytes. PMID: 19859909

Show More

Hide All

Subcellular Location
Mitochondrion intermembrane space. Mitochondrion.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*