Recombinant Rat Galectin-4 (Lgals4)

In Stock
Code CSB-EP012889RAe1
Abbreviation Recombinant Rat Lgals4 protein
MSDS
Size $554
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Lgals4
Uniprot No.
Research Area
Others
Alternative Names
Lgals4; Galectin-4; Gal-4; L-36 lactose-binding protein; L36LBP; Lactose-binding lectin 4
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
1-324aa
Target Protein Sequence
MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSIYIQGIAKDNMRRFHVNFAVGQDEGADIAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGHHFELVFMVMSEHYKVVVNGTPFYEYGHRLPLQMVTHLQVDGDLELQSINFLGGQPAASQYPGTMTIPAYPSAGYNPPQMNSLPVMAGPPIFNPPVPYVGTLQGGLTARRTIIIKGYVLPTAKNLIINFKVGSTGDIAFHMNPRIGDCVVRNSYMNGSWGSEERKIPYNPFGAGQFFDLSIRCGTDRFKVFANGQHLFDFSHRFQAFQRVDMLEIKGDITLSYVQI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
36.3 kDa
Protein Length
Full Length
Tag Info
Tag-Free
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Rat Galectin-4 (Lgals4) is produced in an E.coli expression system, containing amino acids 1-324 to create the full-length protein. The product comes tag-free, which appears to preserve its native form, and shows a purity level greater than 85% as confirmed by SDS-PAGE analysis. It's designed for research use only, with what seems to be a focus on precision and quality for various experimental applications.

Galectin-4 is a carbohydrate-binding protein that likely plays a significant role in cell-cell and cell-matrix interactions. Research suggests it's involved in several biological processes, including modulation of immune responses and regulation of cell growth and apoptosis. As a member of the galectin family, this protein may be crucial in research aimed at understanding its function in cellular communication and signaling pathways.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Rat Lgals4 is a tandem-repeat galectin containing two carbohydrate recognition domains (CRDs) that requires precise folding, proper disulfide bond formation, and correct domain organization for its carbohydrate-binding activity. The E. coli expression system can produce soluble galectins and supports proper disulfide bond formation, which is favorable for this protein family. The tag-free design eliminates potential steric interference with the CRDs. While the expression system is suitable for galectin production, experimental validation remains essential to confirm structural integrity and carbohydrate-binding functionality.

1. Carbohydrate-Binding Specificity Studies

This application is highly suitable if proper folding is verified. Galectin-4's carbohydrate-binding function requires precise CRD formation. If correctly folded and active (validated through binding assays), the protein is excellent for glycan array and SPR studies. If misfolded/unverified, binding studies will yield biologically meaningless results.

2. Antibody Development and Validation

This application is highly suitable regardless of folding status. Antibody development relies on antigenic sequence recognition rather than functional conformation. The full-length protein provides comprehensive epitope coverage for generating specific antibodies against galectin-4.

3. Protein-Protein Interaction Studies

This application requires proper folding validation. Galectin-4 interactions are often carbohydrate-mediated and require functional CRDs. If correctly folded (verified), the protein may identify physiological interaction partners. If misfolded/unverified, there is a risk of non-specific binding or failure to replicate genuine interactions.

4. Structural and Biophysical Characterization

These studies are essential priority applications for determining folding status. Techniques should include analytical ultracentrifugation to assess dimerization state, circular dichroism spectroscopy to evaluate secondary structure, and thermal shift assays to determine stability. The tag-free design is advantageous for high-resolution structural studies.

5. Cell-Based Functional Assays

This application carries a significant risk without functional validation. Cell-based assays require native protein conformation and carbohydrate-binding capability. If correctly folded and active (verified), limited functional studies may be possible. If misfolded/inactive (unverified), cellular assays will yield biologically misleading results.

Final Recommendation & Action Plan

The E. coli expression system with tag-free design is favorable for producing functional galectin-4, but experimental validation of structural integrity and carbohydrate-binding activity is essential before functional applications. Begin with Application 4 (Structural Characterization) to assess folding quality through analytical ultracentrifugation, CD spectroscopy, and validate carbohydrate-binding capability using standard galectin ligands. Once proper folding and functional activity are verified, proceed cautiously with Applications 1, 3, and 5. Application 2 (antibody development) can proceed immediately. Always include appropriate carbohydrate-binding controls and validate key findings with native protein preparations when possible.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Galectin that binds lactose and a related range of sugars.
Gene References into Functions
  1. Data suggest a possible mechanism by which autophagy regulates trophoblast differentiation via regulation of galectin-4 (Gal-4) expression in order to establish the maternal-fetal interface. PMID: 27572741
  2. Gal-4 sorts to axon plasma membrane segments by binding to sulfatide-containing microtubule-associated carriers and organizes the transport of L1, and likely other axonal glycoproteins, by attaching them to the carriers through their LacNAc termini. PMID: 23311731
  3. In the rat placenta, immunohistochemical analysis showed that Gal4 is preferentially located in the maternal-fetal junctional zone. These results suggest that down-regulation of Gal4 may be involved in the promotion of trophoblast cell differentiation PMID: 22877695
  4. This study demonistrated that neuronal galectin-4 as a candidate for a soluble regulator of OLG differentiation and, hence, myelination. PMID: 22431161
  5. The expression of galectin 4 was determined in the rat small intestine during postnatal development. PMID: 15016449

Show More

Hide All

Tissue Specificity
Highly expressed in full-length form in small and large intestine and stomach but was not detected in other tissues including lung, liver, kidney and spleen.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*