Recombinant Rat Galectin-4 (Lgals4)

In Stock
Code CSB-EP012889RAe1
Abbreviation Recombinant Rat Lgals4 protein
MSDS
Size $554
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Lgals4
Uniprot No.
Research Area
Others
Alternative Names
Lgals4; Galectin-4; Gal-4; L-36 lactose-binding protein; L36LBP; Lactose-binding lectin 4
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
1-324aa
Target Protein Sequence
MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSIYIQGIAKDNMRRFHVNFAVGQDEGADIAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGHHFELVFMVMSEHYKVVVNGTPFYEYGHRLPLQMVTHLQVDGDLELQSINFLGGQPAASQYPGTMTIPAYPSAGYNPPQMNSLPVMAGPPIFNPPVPYVGTLQGGLTARRTIIIKGYVLPTAKNLIINFKVGSTGDIAFHMNPRIGDCVVRNSYMNGSWGSEERKIPYNPFGAGQFFDLSIRCGTDRFKVFANGQHLFDFSHRFQAFQRVDMLEIKGDITLSYVQI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
36.3 kDa
Protein Length
Full Length
Tag Info
Tag-Free
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Rat Galectin-4 (Lgals4) is produced in an E.coli expression system, containing amino acids 1-324 to create the full-length protein. The product comes tag-free, which appears to preserve its native form, and shows a purity level greater than 85% as confirmed by SDS-PAGE analysis. It's designed for research use only, with what seems to be a focus on precision and quality for various experimental applications.

Galectin-4 is a carbohydrate-binding protein that likely plays a significant role in cell-cell and cell-matrix interactions. Research suggests it's involved in several biological processes, including modulation of immune responses and regulation of cell growth and apoptosis. As a member of the galectin family, this protein may be crucial in research aimed at understanding its function in cellular communication and signaling pathways.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Carbohydrate-Binding Specificity Studies

This recombinant rat galectin-4 works well in glycan array experiments and surface plasmon resonance assays to characterize its carbohydrate-binding specificity and affinity. Scientists can examine how the protein interacts with various β-galactoside-containing oligosaccharides and glycoconjugates to map out its binding preferences. The tag-free design is particularly valuable here - it means binding studies should reflect the native protein's carbohydrate recognition properties without potential interference from affinity tags. These types of studies appear essential for understanding the molecular basis of galectin-4's biological functions and its role in glycobiology research.

2. Antibody Development and Validation

The full-length recombinant rat galectin-4 works as an ideal antigen for generating specific antibodies against this protein. Scientists can use this purified protein to immunize animals for polyclonal antibody production or as a screening antigen for monoclonal antibody development. The high purity level (>85%) likely ensures consistent and reliable immunization results. The recombinant protein can also validate antibody specificity through ELISA, Western blot, and other immunoassays in galectin-4 research applications.

3. Protein-Protein Interaction Studies

This recombinant galectin-4 proves useful in pull-down assays and co-immunoprecipitation experiments to identify and characterize protein binding partners. Scientists can attach the galectin-4 protein to appropriate matrices to capture interacting proteins from cell lysates or tissue extracts. The tag-free format offers a clear advantage here - it eliminates potential artifacts that might arise from tag-mediated interactions. Such experiments may help clarify the protein networks and signaling pathways involving galectin-4 in various biological processes.

4. Structural and Biophysical Characterization

The purified recombinant rat galectin-4 can support detailed structural studies including X-ray crystallography, NMR spectroscopy, and cryo-electron microscopy experiments. Scientists can investigate the protein's three-dimensional structure, conformational dynamics, and structural changes upon ligand binding. The high purity and tag-free nature appear to make this protein well-suited for biophysical techniques such as dynamic light scattering, analytical ultracentrifugation, and thermal stability assays. These studies provide fundamental insights into the structure-function relationships of galectin-4.

5. Cell-Based Functional Assays

This recombinant galectin-4 can be applied in various cell culture experiments to study its effects on cellular processes such as adhesion, migration, and apoptosis. Scientists can treat cultured cells with the purified protein to investigate dose-dependent responses and examine downstream signaling pathways. The protein also works in cell binding assays to study galectin-4's interaction with cell surface glycoproteins and glycolipids. Such experiments help scientists understand the extracellular functions of galectin-4 in cellular biology and tissue homeostasis.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Galectin that binds lactose and a related range of sugars.
Gene References into Functions
  1. Data suggest a possible mechanism by which autophagy regulates trophoblast differentiation via regulation of galectin-4 (Gal-4) expression in order to establish the maternal-fetal interface. PMID: 27572741
  2. Gal-4 sorts to axon plasma membrane segments by binding to sulfatide-containing microtubule-associated carriers and organizes the transport of L1, and likely other axonal glycoproteins, by attaching them to the carriers through their LacNAc termini. PMID: 23311731
  3. In the rat placenta, immunohistochemical analysis showed that Gal4 is preferentially located in the maternal-fetal junctional zone. These results suggest that down-regulation of Gal4 may be involved in the promotion of trophoblast cell differentiation PMID: 22877695
  4. This study demonistrated that neuronal galectin-4 as a candidate for a soluble regulator of OLG differentiation and, hence, myelination. PMID: 22431161
  5. The expression of galectin 4 was determined in the rat small intestine during postnatal development. PMID: 15016449

Show More

Hide All

Tissue Specificity
Highly expressed in full-length form in small and large intestine and stomach but was not detected in other tissues including lung, liver, kidney and spleen.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*