Recombinant Rat Galectin-4 (Lgals4)

In Stock
Code CSB-EP012889RA
Abbreviation Recombinant Rat Lgals4 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP012889RA could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Lgals4.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP012889RA could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Lgals4.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Lgals4; Galectin-4; Gal-4; L-36 lactose-binding protein; L36LBP; Lactose-binding lectin 4
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
1-324aa
Target Protein Sequence
MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSIYIQGIAKDNMRRFHVNFAVGQDEGADIAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGHHFELVFMVMSEHYKVVVNGTPFYEYGHRLPLQMVTHLQVDGDLELQSINFLGGQPAASQYPGTMTIPAYPSAGYNPPQMNSLPVMAGPPIFNPPVPYVGTLQGGLTARRTIIIKGYVLPTAKNLIINFKVGSTGDIAFHMNPRIGDCVVRNSYMNGSWGSEERKIPYNPFGAGQFFDLSIRCGTDRFKVFANGQHLFDFSHRFQAFQRVDMLEIKGDITLSYVQI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
52.3kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Rat Galectin-4 (Lgals4) is produced using an E.coli expression system and contains the complete sequence spanning amino acids 1-324. The protein comes with an N-terminal 6xHis-SUMO tag, which appears to improve both solubility and purification efficiency. SDS-PAGE analysis shows purity levels above 90%, which should provide reliable results for most research applications. This product is intended for research use only.

Galectin-4 belongs to the galectin family and is known for its ability to bind β-galactoside sugars. The protein seems to play important roles in several cellular processes, including cell adhesion and immune response regulation. Studies suggest that Galectin-4 may influence signaling pathways and cellular communication, making it a useful research tool for those working in cellular biology and immunology.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant Rat Galectin-4 (Lgals4) is expressed in E. coli without any tags. While the tag-free nature is advantageous for maintaining native protein structure, E. coli remains a prokaryotic system generally unsuitable for producing properly folded eukaryotic carbohydrate-binding proteins like galectin-4. This protein requires precise folding with two carbohydrate recognition domains (CRDs) and proper disulfide bond formation for its lectin activity. The protein is full-length (1-324aa) with >85% purity, but E. coli lacks eukaryotic chaperones and quality control machinery. Since activity is unverified, the protein cannot be assumed to be correctly folded or bioactive without experimental validation.

1. Protein-Protein Interaction Studies

This tag-free recombinant rat galectin-4 can be utilized in protein-protein interaction studies through methods such as co-immunoprecipitation or label-free binding assays. The absence of tags avoids potential steric hindrance or artificial interactions that tagged proteins might introduce, better preserving native binding interfaces. Researchers can incubate the recombinant protein with cell lysates or purified candidate binding partners to identify interaction networks involving galectin-4 in carbohydrate recognition and signaling pathways. However, if the protein is misfolded (as is possible with E. coli expression), interactions may not reflect physiological binding relationships. Such studies should therefore include proper controls and validation with native galectin-4 when possible. The >85% purity helps minimize non-specific background binding during interaction experiments.

2. Antibody Development and Validation

This tag-free recombinant rat galectin-4 represents an excellent immunogen for generating antibodies specific to the native protein. The absence of tags ensures antibodies will target authentic galectin-4 epitopes without tag interference. The high purity (>85%) and full-length structure support effective immunization protocols. However, if the protein is misfolded in E. coli (a significant risk), the resulting antibodies may not recognize conformational epitopes of properly folded galectin-4 in rat tissues. Validation against native protein remains essential.

3. Biochemical Characterization and Functional Assays

The tag-free nature makes this galectin-4 highly suitable for biochemical studies, including thermal stability, pH sensitivity, and structural analyses. However, carbohydrate-binding experiments require proper folding to be physiologically relevant. If galectin-4 is misfolded, binding preferences will not reflect native specificity. Functional assays should only be conducted after validating proper folding through biophysical methods and positive controls with known galectin ligands.

4. Comparative Species Studies

This application is highly problematic without folding validation. While the tag-free protein is ideal for evolutionary comparisons in principle, if the rat galectin-4 is misfolded, comparisons with properly folded proteins from other species will yield invalid evolutionary insights. Structural and functional comparisons require all proteins in the comparison to be natively folded. This application should be deferred until proper folding is confirmed.

Final Recommendation & Action Plan

Given the confirmation that this is a tag-free protein, first perform comprehensive biophysical characterization (circular dichroism for secondary structure, analytical ultracentrifugation for oligomeric state) to assess folding quality. Validate carbohydrate-binding activity using known galectin ligands (e.g., lactose, specific glycans) before functional studies. Antibody development can proceed immediately as the highest-priority application. Avoid comparative and interaction studies until proper folding is confirmed. For reliable structural and functional studies, consider validating with galectin-4 from eukaryotic expression systems. The tag-free nature is advantageous but doesn't guarantee proper folding in E. coli.

 

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Galectin that binds lactose and a related range of sugars.
Gene References into Functions
  1. Data suggest a possible mechanism by which autophagy regulates trophoblast differentiation via regulation of galectin-4 (Gal-4) expression in order to establish the maternal-fetal interface. PMID: 27572741
  2. Gal-4 sorts to axon plasma membrane segments by binding to sulfatide-containing microtubule-associated carriers and organizes the transport of L1, and likely other axonal glycoproteins, by attaching them to the carriers through their LacNAc termini. PMID: 23311731
  3. In the rat placenta, immunohistochemical analysis showed that Gal4 is preferentially located in the maternal-fetal junctional zone. These results suggest that down-regulation of Gal4 may be involved in the promotion of trophoblast cell differentiation PMID: 22877695
  4. This study demonistrated that neuronal galectin-4 as a candidate for a soluble regulator of OLG differentiation and, hence, myelination. PMID: 22431161
  5. The expression of galectin 4 was determined in the rat small intestine during postnatal development. PMID: 15016449

Show More

Hide All

Tissue Specificity
Highly expressed in full-length form in small and large intestine and stomach but was not detected in other tissues including lung, liver, kidney and spleen.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*