Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
(Group X secretory phospholipase A2)(GX sPLA2)(sPLA2-X)(Phosphatidylcholine 2-acylhydrolase 10)
Species
Rattus norvegicus (Rat)
Expression Region
29-151aa
Target Protein Sequence
GLLELAGTLDCVGPRSPMAYMNYGCYCGLGGHGEPRDAIDWCCYYHDCCYSQAQDAGCSPKLYRYPWKCMDHRILCGPAENKCQELLCRCDETLAYCLADTEYHLKYLFFPSVLCEKDSPKCN
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The gene fragment encoding the full-length mature rat Pla2g10 protein (29-151aa), including the desired N-terminal 10xHis-tag and C-terminal Myc-tag, is cloned into an appropriate expression vector. The recombinant expression vector carrying the Pla2g10 gene fragment is transformed into competent E. coli cells. The transformed cells are selected and cultured for recombinant protein expression. After a suitable induction period, the E. coli cells are harvested and lysed to release the cellular contents, including the expressed recombinant Pla2g10 protein. The purity of the recombinant rat Pla2g10 protein is greater than 90% measured by SDS-PAGE. This recombinant Pla2g10 protein migrated on the gel to a band with a molecular weight of 22 kDa.