Recombinant Rat Group 10 secretory phospholipase A2 (Pla2g10)

In Stock
Code CSB-EP874149RA
Abbreviation Recombinant Rat Pla2g10 protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
(Group X secretory phospholipase A2)(GX sPLA2)(sPLA2-X)(Phosphatidylcholine 2-acylhydrolase 10)
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
29-151aa
Target Protein Sequence
GLLELAGTLDCVGPRSPMAYMNYGCYCGLGGHGEPRDAIDWCCYYHDCCYSQAQDAGCSPKLYRYPWKCMDHRILCGPAENKCQELLCRCDETLAYCLADTEYHLKYLFFPSVLCEKDSPKCN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
21.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The process of producing recombinant rat Pla2g10 in E. coli involves co-inserting the target gene into an expression vector with an N-terminal 10xHis-tag and C-terminal Myc-tag gene, which is introduced into E. coli cells. The target gene codes for the 29-151aa of rat Pla2g10 protein. The cells are grown and induced to express the rat Pla2g10 protein. The cells are lysed to release the expressed Pla2g10 protein, which is purified using affinity chromatography technique. Protein purity is assessed using SDS-PAGE, exceeding 90%.

PLA2G10 protein is a phospholipase A2 enzyme in various physiological processes. PLA2G10 has been implicated in cancer progression, where its catalytic activity contributes to impairing T-cell infiltration, thereby dampening immunity [1]. It modulates lipid metabolism, promoting breast cancer cell growth and survival by stimulating lipid droplet formation and fatty acid oxidation [2]. In the context of colon tumorigenesis, PLA2G10 exhibits potent activity in releasing arachidonic acid, leading to prostaglandin E2 formation [3].

Furthermore, PLA2G10 has been associated with various physiological functions beyond cancer. For example, it has been identified as a novel progesterone receptor target gene induced in the uterine luminal epithelium, playing a role in uterine receptivity for embryo implantation [4]. Additionally, PLA2G10 has been linked to skin homeostasis, with its enzymatic activity transiently elevated before hair loss, suggesting a role in hair follicular function [5]. Moreover, studies have shown that PLA2G10 deficiency can lead to reduced myocardial ischemia-reperfusion injury, indicating its involvement in inflammatory responses and tissue damage [6].

References:
[1] T. Zhang, Up-regulated pla2g10 in cancer impairs t cell infiltration to dampen immunity, Science Immunology, vol. 9, no. 94, 2024. https://doi.org/10.1126/sciimmunol.adh2334
[2] S. Park, E. Huang, & T. Ahn, Classification and functional analysis between cancer and normal tissues using explainable pathway deep learning through rna-sequencing gene expression, International Journal of Molecular Sciences, vol. 22, no. 21, p. 11531, 2021. https://doi.org/10.3390/ijms222111531
[3] Y. Liu, X. Zhu, J. Zhu, S. Liao, Q. Tang, K. Liuet al., Identification of differential expression of genes in hepatocellular carcinoma by suppression subtractive hybridization combined cdna microarray, Oncology Reports, 2007. https://doi.org/10.3892/or.18.4.943
[4] H. Park, S. Park, M. Lee, G. Kim, S. Park, S. Yanget al., Secretory phospholipase a2-x (pla2g10) is a novel progesterone receptor target gene exclusively induced in uterine luminal epithelium for uterine receptivity in mice,, 2020. https://doi.org/10.21203/rs.3.rs-41891/v2
[5] K. Yamamoto, Y. Taketomi, Y. Isogai, Y. Miki, H. Sato, S. Masudaet al., Hair follicular expression and function of group x secreted phospholipase a2 in mouse skin, Journal of Biological Chemistry, vol. 286, no. 13, p. 11616-11631, 2011. https://doi.org/10.1074/jbc.m110.206714
[6] S. Gora, C. Perret, I. Jemel, V. Nicaud, G. Lambeau, F. Cambienet al., Molecular and functional characterization of polymorphisms in the secreted phospholipase a2 group x gene: relevance to coronary artery disease, Journal of Molecular Medicine, vol. 87, no. 7, p. 723-733, 2009. https://doi.org/10.1007/s00109-009-0483-y
[7] Q. Huang, Y. Wu, C. Qin, W. He, & X. Wei, Phylogenetic and structural analysis of the phospholipase a2 gene family in vertebrates, International Journal of Molecular Medicine, vol. 35, no. 3, p. 587-596, 2014. https://doi.org/10.3892/ijmm.2014.2047

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Secretory calcium-dependent phospholipase A2 that primarily targets extracellular phospholipids. Hydrolyzes the ester bond of the fatty acyl group attached at sn-2 position of phospholipids with preference for phosphatidylcholines and phosphatidylglycerols over phosphatidylethanolamines. Preferentially releases sn-2 omega-6 and omega-3 polyunsaturated fatty acyl (PUFA) chains over saturated fatty acyls. Contributes to phospholipid remodeling of very low-density lipoprotein (VLDL), low-density lipoprotein (LDL) and high-density lipoprotein (HDL) particles. Hydrolyzes LDL phospholipids releasing unsaturated fatty acids that regulate macrophage differentiation toward foam cells. Efficiently hydrolyzes and inactivates platelet activating factor (PAF), a potent lipid mediator present in oxidized LDL. May act in an autocrine and paracrine manner. Secreted by lung epithelium, targets membrane phospholipids of infiltrating eosinophils, releasing arachidonate and boosting eicosanoid and cysteinyl leukotriene synthesis involved in airway inflammatory response. Secreted by gut epithelium, hydrolyzes dietary and biliary phosphatidylcholines in the gastrointestinal lumen. Plays a stem cell regulator role in colon epithelium. Within intracellular compartment, mediates Paneth-like cell differentiation and its stem cell supporting functions by inhibiting the Wnt signaling pathway in intestinal stem cell (ISC). Secreted in the intestinal lumen upon inflammation, acts in an autocrine way and promotes prostaglandin E2 synthesis that stimulates Wnt signaling pathway in ISCs and tissue regeneration. May participate in hair follicle morphogenesis by regulating phosphatidylethanolamines metabolism at the outermost epithelial layer and facilitating melanin synthesis. By releasing lysophosphatidylcholines (LPCs) at sperm acrosome, controls sperm cell capacitation, acrosome reaction and overall fertility. May promote neurite outgrowth in neuron fibers involved in nociception. Contributes to lipid remodeling of cellular membranes and generation of lipid mediators involved in pathogen clearance. Cleaves sn-2 fatty acyl chains of phosphatidylglycerols and phosphatidylethanolamines, which are major components of membrane phospholipids in bacteria. Displays bactericidal activity against Gram-positive bacteria by directly hydrolyzing phospholipids of the bacterial membrane. In pulmonary epithelium, may contribute to host defense response against adenoviral infection. Prevents adenovirus entry into host cells by hydrolyzing host cell plasma membrane, releasing C16:0 LPCs that inhibit virus-mediated membrane fusion and viral infection. Likely prevents adenoviral entry into the endosomes of host cells. May play a role in maturation and activation of innate immune cells including macrophages, group 2 innate lymphoid cells and mast cells.
Gene References into Functions
  1. group X secreted phospholipase A2 is expressed in neural cells and has neuritogenic action PMID: 15781456
Subcellular Location
Secreted. Lysosome. Cytoplasmic vesicle, secretory vesicle, acrosome.
Protein Families
Phospholipase A2 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*