Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Hpse

Uniprot No.

Q71RP1

Research Area

Cancer

Alternative Names

Hpse; HepHeparanase; EC 3.2.1.166; Endo-glucoronidase) [Cleaved into: Heparanase 8 kDa subunit; Heparanase 50 kDa subunit]

Species

Rattus norvegicus (Rat)

Source

E.coli

Expression Region

29-102aa

Target Protein Sequence

KDVVDLEFYTKRLFQSVSPSFLSITIDASLATDPRFLTFLGSPRLRALARGLSPAYLRFGGTKTDFLIFDPNKE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

15.8 kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer，50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Endoglycosidase that cleaves heparan sulfate proteoglycans (HSPGs) into heparan sulfate side chains and core proteoglycans. Participates in extracellular matrix (ECM) degradation and remodeling. Selectively cleaves the linkage between a glucuronic acid unit and an N-sulfo glucosamine unit carrying either a 3-O-sulfo or a 6-O-sulfo group. Can also cleave the linkage between a glucuronic acid unit and an N-sulfo glucosamine unit carrying a 2-O-sulfo group, but not linkages between a glucuronic acid unit and a 2-O-sulfated iduronic acid moiety. It is essentially inactive at neutral pH but becomes active under acidic conditions such as during tumor invasion and in inflammatory processes. Facilitates cell migration associated with metastasis, wound healing and inflammation. Enhances shedding of syndecans, and increases endothelial invasion and angiogenesis in myelomas. Acts as procoagulant by increasing the generation of activation factor X in the presence of tissue factor and activation factor VII. Increases cell adhesion to the extracellular matrix (ECM), independent of its enzymatic activity. Induces AKT1/PKB phosphorylation via lipid rafts increasing cell mobility and invasion. Heparin increases this AKT1/PKB activation. Regulates osteogenesis. Enhances angiogenesis through up-regulation of SRC-mediated activation of VEGF. Implicated in hair follicle inner root sheath differentiation and hair homeostasis.

Gene References into Functions

Heparanase plays an important role in mediating the neuroinflammatory response after subarachnoid hemorrhage. PMID: 28720149
Endothelial cell-to-cardiomyocyte transfer of heparanase to modulates the cardiomyocyte cell death signature. This mechanism was observed in the acutely diabetic heart, and its interruption following chronic diabetes may contribute towards the development of diabetic cardiomyopathy. PMID: 27979811
the expression of the gene for heparanase was increased in the right and left ventricles after treatment with monocrotaline PMID: 26638897
Inhibiting heparanase function could offer a new strategy for managing cardiomyopathy observed after diabetes. PMID: 24608441
Suggest that the heparanase-lipoprotein lipase-VEGF axis amplifies fatty acid delivery, a rapid and adaptive mechanism that is geared to overcome the loss of glucose consumption by the diabetic heart. PMID: 24115032
active heparanase released lipoprotein lipase from the myocyte surface PMID: 23471235
Heparanase and TFPI are locally elevated in the process of avascular necrosis and are normalized on treatment. PMID: 23063054
Heparanase gene is involved in heparan sulfate proteoglycans metabolism. PMID: 22339633
HPR1 production is increased in endothelial cells from rat models of diabetes, and in macrophages in atherosclerotic lesions of diabetic and nondiabetic patients. Increased HPR1 production may contribute to pathogenesis and progression of atherosclerosis. PMID: 21424539
Heparanase was upregulated and associated with increased VEGF in streptozotocin diabetic rat retinas. Heparanase may be involved in development of diabetic retinopathy and may be possible novel target for therapeutic intervention. PMID: 20130710
Characterization of a novel intracellular heparanase that has a FERM domain. PMID: 11988100
characterization of rat heparanase activity in a parathyroid cell line PMID: 12077130
heparanase gene transcription is regulated in activated T cells by early growth response 1 PMID: 14522979
Heparanase plays a role in ovaian tissue remodeling during folliculogenesis and forpus luteum formation and regression. PMID: 15728796
heparanase contributes to the pathogenesis of proteinuria in a model of anti-GBM disease PMID: 15877677
Results describe the cellular localization of heparanase and its colocalization with syndecan-3 in spinal cords of adult rats. PMID: 16320243
These results suggest involvement of radicals and angiotensin II in the modulation of glomerular basement membrane permeability through heparan sulfate and heparanase expression. PMID: 16899518
HPSE is involved in the pathogenesis of proteinuria in overt diabetic nephropathy by degradation of heparan sulfates PMID: 17051139
The expression of heparanase by astrocytes may correlate with the time of migration of reactive astrocytes toward the ischemic core, resulting in astrogliosis. This suggests a novel role of heparanase in the pathophysiology of brain ischemia. PMID: 17368723
Results suggest the involvement of heparanase in the migration or invasion of microglia or brain macrophages across basement membrane around brain vasculature. PMID: 18222122
results suggest heparanase expression increases after castration & correlates with decreased heparan sulfate; variation in heparanase expression is involved in tissue remodeling & control of regressive pattern after 1 week of androgen deprivation PMID: 18278514
role for heparanase in the regulation of arterial structure, mechanics, and repair PMID: 19096032
Following hyperglycemia, translocation of lipoprotein lipase from cardiomyocytes to endothelial cells is dependent on fatty acids to increase endothelial intracellular heparanase followed by secretion of heparanase by glucose. PMID: 19218500

Hide All

Subcellular Location

Lysosome membrane; Peripheral membrane protein. Secreted. Nucleus.

Protein Families

Glycosyl hydrolase 79 family

Database Links

KEGG: rno:64537

UniGene: Rn.6392

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-EP010716RA
MSDS	MSDS
Size	US$388
	Order now
Promotion
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Rat Heparanase (Hpse), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage