Recombinant Rat Heparanase (Hpse), partial

In Stock
Code CSB-EP010716RA
Abbreviation Recombinant Rat Hpse protein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Hpse
Uniprot No.
Research Area
Cancer
Alternative Names
Hpse; HepHeparanase; EC 3.2.1.166; Endo-glucoronidase) [Cleaved into: Heparanase 8 kDa subunit; Heparanase 50 kDa subunit]
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
29-102aa
Target Protein Sequence
KDVVDLEFYTKRLFQSVSPSFLSITIDASLATDPRFLTFLGSPRLRALARGLSPAYLRFGGTKTDFLIFDPNKE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
15.8 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Endoglycosidase that cleaves heparan sulfate proteoglycans (HSPGs) into heparan sulfate side chains and core proteoglycans. Participates in extracellular matrix (ECM) degradation and remodeling. Selectively cleaves the linkage between a glucuronic acid unit and an N-sulfo glucosamine unit carrying either a 3-O-sulfo or a 6-O-sulfo group. Can also cleave the linkage between a glucuronic acid unit and an N-sulfo glucosamine unit carrying a 2-O-sulfo group, but not linkages between a glucuronic acid unit and a 2-O-sulfated iduronic acid moiety. It is essentially inactive at neutral pH but becomes active under acidic conditions such as during tumor invasion and in inflammatory processes. Facilitates cell migration associated with metastasis, wound healing and inflammation. Enhances shedding of syndecans, and increases endothelial invasion and angiogenesis in myelomas. Acts as procoagulant by increasing the generation of activation factor X in the presence of tissue factor and activation factor VII. Increases cell adhesion to the extracellular matrix (ECM), independent of its enzymatic activity. Induces AKT1/PKB phosphorylation via lipid rafts increasing cell mobility and invasion. Heparin increases this AKT1/PKB activation. Regulates osteogenesis. Enhances angiogenesis through up-regulation of SRC-mediated activation of VEGF. Implicated in hair follicle inner root sheath differentiation and hair homeostasis.
Gene References into Functions
  1. Heparanase plays an important role in mediating the neuroinflammatory response after subarachnoid hemorrhage. PMID: 28720149
  2. Endothelial cell-to-cardiomyocyte transfer of heparanase to modulates the cardiomyocyte cell death signature. This mechanism was observed in the acutely diabetic heart, and its interruption following chronic diabetes may contribute towards the development of diabetic cardiomyopathy. PMID: 27979811
  3. the expression of the gene for heparanase was increased in the right and left ventricles after treatment with monocrotaline PMID: 26638897
  4. Inhibiting heparanase function could offer a new strategy for managing cardiomyopathy observed after diabetes. PMID: 24608441
  5. Suggest that the heparanase-lipoprotein lipase-VEGF axis amplifies fatty acid delivery, a rapid and adaptive mechanism that is geared to overcome the loss of glucose consumption by the diabetic heart. PMID: 24115032
  6. active heparanase released lipoprotein lipase from the myocyte surface PMID: 23471235
  7. Heparanase and TFPI are locally elevated in the process of avascular necrosis and are normalized on treatment. PMID: 23063054
  8. Heparanase gene is involved in heparan sulfate proteoglycans metabolism. PMID: 22339633
  9. HPR1 production is increased in endothelial cells from rat models of diabetes, and in macrophages in atherosclerotic lesions of diabetic and nondiabetic patients. Increased HPR1 production may contribute to pathogenesis and progression of atherosclerosis. PMID: 21424539
  10. Heparanase was upregulated and associated with increased VEGF in streptozotocin diabetic rat retinas. Heparanase may be involved in development of diabetic retinopathy and may be possible novel target for therapeutic intervention. PMID: 20130710
  11. Characterization of a novel intracellular heparanase that has a FERM domain. PMID: 11988100
  12. characterization of rat heparanase activity in a parathyroid cell line PMID: 12077130
  13. heparanase gene transcription is regulated in activated T cells by early growth response 1 PMID: 14522979
  14. Heparanase plays a role in ovaian tissue remodeling during folliculogenesis and forpus luteum formation and regression. PMID: 15728796
  15. heparanase contributes to the pathogenesis of proteinuria in a model of anti-GBM disease PMID: 15877677
  16. Results describe the cellular localization of heparanase and its colocalization with syndecan-3 in spinal cords of adult rats. PMID: 16320243
  17. These results suggest involvement of radicals and angiotensin II in the modulation of glomerular basement membrane permeability through heparan sulfate and heparanase expression. PMID: 16899518
  18. HPSE is involved in the pathogenesis of proteinuria in overt diabetic nephropathy by degradation of heparan sulfates PMID: 17051139
  19. The expression of heparanase by astrocytes may correlate with the time of migration of reactive astrocytes toward the ischemic core, resulting in astrogliosis. This suggests a novel role of heparanase in the pathophysiology of brain ischemia. PMID: 17368723
  20. Results suggest the involvement of heparanase in the migration or invasion of microglia or brain macrophages across basement membrane around brain vasculature. PMID: 18222122
  21. results suggest heparanase expression increases after castration & correlates with decreased heparan sulfate; variation in heparanase expression is involved in tissue remodeling & control of regressive pattern after 1 week of androgen deprivation PMID: 18278514
  22. role for heparanase in the regulation of arterial structure, mechanics, and repair PMID: 19096032
  23. Following hyperglycemia, translocation of lipoprotein lipase from cardiomyocytes to endothelial cells is dependent on fatty acids to increase endothelial intracellular heparanase followed by secretion of heparanase by glucose. PMID: 19218500

Show More

Hide All

Subcellular Location
Lysosome membrane; Peripheral membrane protein. Secreted. Nucleus.
Protein Families
Glycosyl hydrolase 79 family
Database Links

KEGG: rno:64537

UniGene: Rn.6392

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*