Recombinant Rat Lutropin-choriogonadotropic hormone receptor (Lhcgr), partial

Code CSB-MP012911RA
Abbreviation Recombinant Rat Lhcgr protein, partial
MSDS
Size $440
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
LhcgrLutropin-choriogonadotropic hormone receptor; LH/CG-R; Luteinizing hormone receptor; LSH-R
Species
Rattus norvegicus (Rat)
Source
Mammalian cell
Expression Region
27-362aa
Target Protein Sequence
RELSGSRCPEPCDCAPDGALRCPGPRAGLARLSLTYLPVKVIPSQAFRGLNEVVKIEISQSDSLERIEANAFDNLLNLSELLIQNTKNLLYIEPGAFTNLPRLKYLSICNTGIRTLPDVTKISSSEFNFILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLISLELKENIYLEKMHSGAFQGATGPSILDISSTKLQALPSHGLESIQTLIALSSYSLKTLPSKEKFTSLLVATLTYPSHCCAFRNLPKKEQNFSFSIFENFSKQCESTVRKADNETLYSAIFEENELSGWDYDYGFCSPKTLQCAPEPDAFNPCEDIMG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
47.8kDa
Protein Length
partial
Tag Info
C-terminal Flag-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
Gene References into Functions
  1. MiR-122 plays a regulatory role in LHCGR expression. PMID: 27940300
  2. these results suggest that hCG-induced LHR mRNA downregulation is mediated by cAMP-PKA-ERK1/2 signaling leading to activation of eIF5A hypusination. PMID: 26116232
  3. Demonstrate the presence of LH receptors. Activation resulted in a dose-dependent increase in glucose-induced release of insulin. PMID: 25670721
  4. miR-122 plays a regulatory role in LH/hCG-induced LHR mRNA down-regulation by increasing LRBP expression through the activation of the SREBP pathway. PMID: 26125464
  5. interaction of NF-kappaB p65 with histone deacetylase in the promoter region of Lhcgr might be responsible for TNF-alpha action on the regulation of LH receptor PMID: 26125466
  6. Palmitoylated peptide 562-572 of luteinizing hormone receptor increases testosterone level in male rats. PMID: 25430649
  7. miR-136-3p participated in the down-regulation of LHR mRNA by binding directly to LHR mRNA. PMID: 24025743
  8. IL-6 up-regulates FSH-induced LHR production by increasing mRNA transcription, and JAK/signal transducer and activator of transcription 3 signaling is required for up-regulation by IL-6 in granulosa cells PMID: 24467743
  9. protein kinase A, upon activation in response to FSH signaling to raise intracellular cAMP levels in granulosa cells, phosphorylatesbeta-catenin on 2 C-terminal Serine residues to function as a co-activator for both SF1 and TCF3 on the Lhcgr promoter. PMID: 23754802
  10. These data suggest that the association of LRBP with Luteinizing hormone receptor mRNA results in the translocation of the messenger ribonucleoprotein complex to the p bodies leading to decapping and degradation. PMID: 23376535
  11. These results reveal a novel mechanism of luteinizing hormone receptor regulation by GRP78 in the early stage of corpus luteum formation. PMID: 23175774
  12. that LH acts on the uterus to inhibit contraction at ovulation. PMID: 22367228
  13. Neuropeptide Y activity in the medial preoptic area which affects luteinizing hormone surge may be controlled by locus coerulus neurons. PMID: 16336998
  14. VEGF-A-induced vascularization of the ovary is dictated by the expression of LHR and this might play a regulatory role in ovarian physiology. PMID: 20619315
  15. LHR signaling via PKA activates a cofilin-regulated rearrangement of the actin cytoskeleton and active cofilin is required to initiate progesterone secretion by preovulatory granulosa cells. PMID: 20610540
  16. heterozygous mutation can rescue hormone action PMID: 11859079
  17. Post-transcriptional regulation of luteinizing hormone receptor mRNA in the ovary by a novel mRNA-binding protein (LRBP) PMID: 11940568
  18. the findings demonstrate that Egr-1 actually binds to the regulatory upstream region of the LH receptor gene and positively regulates receptor gene expression PMID: 12021067
  19. A model for constitutive activation is based on molecular simulation and engineered mutations in transmembrane helices 6 and 7 PMID: 12070159
  20. lutropin receptor conformation and molecular model PMID: 12141913
  21. expressed in the adult rat spinal cord PMID: 12505611
  22. Conserved Glu and Asp residues in ligand-mediated signaling buffer dependent in LHR. Identical amino acid residues in homologous receptors can exhibit distinct functions. Role of ionic strength (Na+) on signaling differs in the three receptors. PMID: 12588044
  23. In rat ovaries, MAb found 6 distinct LHR bands migrating at approximately 92, 80, 68, 59, 52 & 48 kDa. There is a possible role for LHR in the development of abnormal pregnancy, pelvic floor disorders & Alzheimer's disease. PMID: 12816543
  24. Chronic elevation of ovarian cAMP leads to a decreased expression of LHR mRNA with a concomitant increase in LHR mRNA binding activity of LHR mRNA binding protein . PMID: 15767047
  25. LHR protein is expressed constitutively in gonadal and nongonadal urogenital tissues as well in adrenal glands, but its final functional maturation at the posttranslational level appears to be developmentally and physiologically regulated. PMID: 15860556
  26. These results show that glycosylation of the LH receptor plays an important role in receptor processing and cell surface expression. PMID: 15866423
  27. luteinizing hormone receptor expression at the cell surface may be controlled at the ER level by regulating the number of newly synthesized proteins that will mature and escape the ER quality control and premature degradation PMID: 15901736
  28. LRBP is a translational inhibitor of LHR mRNA in the ovary PMID: 16263716
  29. The common rat LHR ectodomain splice variant alters the behavior of the full-length receptor by misrouting it away from the normal secretory pathway in human embryonic kidney 293 cells. PMID: 16495341
  30. The data presented here support the model of glycoprotein hormone-receptor interaction in which the hormone binds to the extracellular domain through the beta subunit and then the alpha subunit is brought in contact with the transmembrane domain. PMID: 17045394
  31. These results therefore show that LH receptor mRNA expression in the ovary is regulated post-transcriptionally by altering the rate of mRNA degradation by a specific mRNA binding protein. PMID: 17055149
  32. Results show that metyrapone-induced corticosterone deficiency impairs Leydig cell insulin and prolactin, but not LH, receptors, and their mRNA expression and the response of Leydig cells to LH/PRL/insulin on testosterone production. PMID: 18313837
  33. phosphorylation status of the AKAP MAP2D is acutely regulated by LH receptor-mediated modulation of kinase and phosphatase activities via PKA PMID: 18467524
  34. an intact active site of MVK is required for its binding to rat LHR mRNA and for its translational suppressor function PMID: 18494797
  35. The LHR-stimulated ERK1/2 pathway stimulates epiregulin release. PMID: 18653716
  36. These results suggest that the extracellular domain of the LHR is one of the determinants that confer its ability for proper maturation and cell surface expression. PMID: 18848524
  37. LHCGR mRNA is expressed as a function of the passage of granulosa cells across the G1-S phase boundary PMID: 19293332
  38. during ligand-induced downregulation, LRBP translocates to ribosomes and associates with LHR mRNA to form an untranslatable ribonucleoprotein complex and inhibits LHR mRNA translation, paving the way to its degradation. PMID: 19716387

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Secreted. Note=Some isoforms may be secreted.
Protein Families
G-protein coupled receptor 1 family, FSH/LSH/TSH subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*