Recombinant Rat Lutropin-choriogonadotropic hormone receptor(Lhcgr),partial

Code CSB-EP012911RA
Product Type Recombinant Protein
Size US$2466
Uniprot No. P16235
Relevance Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Luteinizing hormone receptor ;LSH-R
Species Rattus norvegicus (Rat)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence RELSGSRCPEPCDCAPDGALRCPGPRAGLARLSLTYLPVKVIPSQAFRGLNEVVKIEISQSDSLERIEANAFDNLLNLSELLIQNTKNLLYIEPGAFTNLPRLKYLSICNTGIRTLPDVTKISSSEFNFILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLISLELKENIYLEKMHSGAFQGATGPSILDISSTKLQALPSHGLESIQTLIALSSYSLKTLPSKEKFTSLLVATLTYPSHCCAFRNLPKKEQNFSFSIFENFSKQCESTVRKADNETLYSAIFEENELSGWDYDYGFCSPKTLQCAPEPDAFNPCEDIMG
Research Area Others
Source E.coli
Gene Names Lhcgr
Protein Names Recommended name: Lutropin-choriogonadotropic hormone receptor Short name= LH/CG-RAlternative name(s): Luteinizing hormone receptor Short name= LSH-R
Expression Region 27-362aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 53.2kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
Subcellular Location Cell membrane, Multi-pass membrane protein, Secreted
Protein Families G-protein coupled receptor 1 family, FSH/LSH/TSH subfamily
Database Links

KEGG: rno:25477

STRING: 10116.ENSRNOP00000022481

UniGene: Rn.11216

Pathway Calcium signaling pathway

Related Products

Lhcgr Antibodies

Lhcgr Antibodies for Rat

Lhcgr Proteins

Lhcgr Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.