Recombinant Rat Lutropin subunit beta (Lhb)

In Stock
Code CSB-EP012910RA
Abbreviation Recombinant Rat Lhb protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Lhb
Uniprot No.
Research Area
Others
Alternative Names
Luteinizing hormone subunit beta
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
21-141aa
Target Protein Sequence
SRGPLRPLCRPVNATLAAENEFCPVCITFTTSICAGYCPSMVRVLPAALPPVPQPVCTYRELRFASVRLPGCPPGVDPIVSFPVALSCRCGPCRLSSSDCGGPRTQPMTCDLPHLPGLLLF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
19.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids.
Gene References into Functions
  1. Orchestrated Egr1 and Pitx1 activities depending on specific central and peripheral regulatory inputs could be responsible for physiologically variable Lhb gene promoter activation in vivo. PMID: 25258388
  2. GnRH stimulates AMPK, and AMPK inhibition suppresses GnRH-stimulated LHbeta transcription. PMID: 23518923
  3. data suggest that the molecular decision for LHbeta subunit to enter the regulated secretory pathway is a pre-Golgi event controlled by the C-terminal heptapeptide. PMID: 23734233
  4. increased LH concentration induces production of incomplete LHR transcripts in hippocampal cells and decreases immature LHR at the protein level PMID: 23678542
  5. Data suggest that LH beta subunit expression (and FSH beta subunit expression) is regulated by DUSP1 expression (specifically in response to high-frequency GnRH pulses); this effect may occur in association with MAPK3/1 phosphorylation. PMID: 21228211
  6. Complex interactions between Ahr and Esr alter Prl and luteinizing hormone (LH) synthesis by direct actions in lactotropes and gonadotropes. PMID: 21187122
  7. LHbeta promoter activity is further regulated by the orphan nuclear receptors, chicken ovalbumin upstream promoter-transcription factors (COUP-TFI and COUP-TFII). PMID: 20797425
  8. data suggest that LHbeta G1502A polymorphism may be involved in the predisposition to infertility and minimal/mild endometriosis-associated infertility, although endometriosis might be only a coincidental finding along with infertility. PMID: 20430510
  9. PACAP may be released from the anterior pituitary cells in a concentration which would be able to influence LH release not only in vitro but under in vivo conditions as well. PMID: 12409218
  10. These results suggest that GnRH directly regulates LH secretion as well as LHbeta-subunit synthesis, and that LH2 cells are a useful model for the study of LH secretion induced by several secretagogues. PMID: 12940464
  11. androgens acting directly on the pituitary increase FSH-beta and decrease LH-beta transcription PMID: 14512439
  12. identify a second functional Pitx1 region spanning positions -73 to -52 in the LHbeta gene promoter PMID: 16087728
  13. JNK regulates both LHbeta and FSHbeta transcription in a differential manner. PMID: 17932215
  14. LHbeta, FSHbeta and the common alpha-subunit mRNA's were detected in intact follicles, theca cells, corpora lutea and in meiotically competent and incompetent oocytes. PMID: 18248883
  15. the carboxyl-terminal sequence in the lutropin beta subunit contributes to the sorting of lutropin to the regulated pathway PMID: 18292086
  16. In the 14-day-old rat pituitary, the majority of GHRH target cells are cells expressing LH beta mRNA alone or in combination with GH and/or POMC mRNA. PMID: 18363807
  17. Results demonstrate that degradation via the proteasome is vital to GnRH-stimulated LHbeta expression, and this occurs in part by allowing proper transcription factor associations with the LHbeta promoter. PMID: 19095772
  18. Lhb gene transcription in rat pituitary requires GnRH-induced early growth response 1 gene expression, which is mediated by MAPK8/9 and MAPK1/3. PMID: 19710510

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Glycoprotein hormones subunit beta family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*