Recombinant Rat Myosin-binding protein C, cardiac-type(Mybpc3),partial

Code CSB-YP015267RA
Product Type Recombinant Protein
Size US$2474
Uniprot No. P56741
Relevance Thick filament-associated protein located in the crossbridge region of vertebrate striated muscle a bands. In vitro it binds MHC, F-actin and native thin filaments, and modifies the activity of actin-activated myosin ATPase. It may modulate muscle contraction or may play a more structural role.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias C-protein, cardiac muscle isoform
Species Rattus norvegicus (Rat)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence PKIHLDCPGSTPDTIVVVAGNKLRLDVPISGDPAPTVIWQKTITQGKKASAGPPPGAPEDAGADEEWVFDKKLLCETEGRVRVETTKDRSVFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCIVQWEPPAYDGGQPVLGYILERKKKKSYRWMRLNFDLLRELSHEARRMIEGVAYEMRVYAVNAVGMSRPSPASQPF
Research Area Others
Source Yeast
Gene Names Mybpc3
Protein Names Recommended name: Myosin-binding protein C, cardiac-type Short name= Cardiac MyBP-C Alternative name(s): C-protein, cardiac muscle isoform
Expression Region 645-864aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 26.1kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Thick filament-associated protein located in the crossbridge region of vertebrate striated muscle a bands. In vitro it binds MHC, F-actin and native thin filaments, and modifies the activity of actin-activated myosin ATPase. It may modulate muscle contraction or may play a more structural role.
Protein Families Immunoglobulin superfamily, MyBP family
Database Links

KEGG: rno:295929

STRING: 10116.ENSRNOP00000016652

UniGene: Rn.162668

Related Products

Mybpc3 Antibodies

Mybpc3 Antibodies for Rat

Mybpc3 Proteins

Mybpc3 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.