Recombinant Rat Osteocalcin (Bglap)

In Stock
Code CSB-EP002682RA
Abbreviation Recombinant Rat Bglap protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Bglap; Bglap2; Osteocalcin; Bone Gla protein; BGP; Gamma-carboxyglutamic acid-containing protein
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
50-99aa
Target Protein Sequence
YLNNGLGAPAPYPDPLEPHREVCELNPNCDELADHIGFQDAYKRIYGTTV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.6kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Rat Osteocalcin (Bglap) is expressed in E. coli and includes an N-terminal GST tag that makes purification more straightforward. The protein contains the full length of mature osteocalcin—specifically the 50-99 amino acid region. SDS-PAGE analysis confirms purity levels above 90%, suggesting this is a reliable reagent for research work.

Osteocalcin, sometimes called bone gamma-carboxyglutamic acid-containing protein, seems to play a central role in how bones metabolize and mineralize. Osteoblasts produce this protein, and it likely helps regulate bone formation and calcium ion balance. Many researchers study osteocalcin as a marker of bone turnover, making it an attractive target for investigations into bone health and metabolic diseases.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Rat osteocalcin (Bglap) is a small, secreted protein that requires specific post-translational modifications (particularly gamma-carboxylation of glutamic acid residues) for its calcium-binding activity and biological function in bone mineralization. The E. coli expression system cannot perform these vitamin K-dependent carboxylation modifications. While the protein may achieve some level of secondary structure, it will lack the critical gamma-carboxyl groups necessary for functional activity. The GST tag may help with solubility, but it does not compensate for the missing modifications. Therefore, this recombinant protein is highly unlikely to be functionally active, though it may have some structural elements.

1. Antibody Development and Validation

This recombinant osteocalcin serves as an excellent immunogen for generating antibodies specific to the rat osteocalcin sequence. The high purity and full-length mature protein sequence ensure broad epitope coverage. These antibodies will be valuable for detecting both modified and unmodified forms of osteocalcin in techniques like Western blotting. However, they may have varying affinity for the gamma-carboxylated form found in biological systems.

2. ELISA Development

This protein is well-suited as a standard for quantitative ELISA assays to measure total osteocalcin immunoreactivity. As an immunoassay standard, the protein's sequence and purity are sufficient. For functional binding studies, the missing modifications make it inappropriate.

3. Biochemical Characterization and Stability Studies

This is an essential application for understanding the properties of this specific recombinant protein. Techniques like circular dichroism can assess its secondary structure content, while thermal shift assays can determine its stability under various conditions. These studies provide crucial quality control data and help understand how the lack of gamma-carboxylation affects the protein's physical properties.

Final Recommendation & Action Plan

This recombinant osteocalcin is valuable for immunological and biochemical characterization applications but unsuitable for functional studies requiring native post-translational modifications. The recommended approach is to prioritize Application 3 (Biochemical Characterization) to establish the protein's stability and structural properties, then proceed confidently with Application 1 (Antibody Development) and Application 2 (as an ELISA standard). For interaction studies, the protein should only be used for preliminary screening with the understanding that all findings must be validated using properly carboxylated osteocalcin from mammalian sources. For functional binding studies, alternative approaches using osteocalcin from mammalian expression systems or native purification from bone tissue are necessary to obtain biologically relevant results.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.
Gene References into Functions
  1. These data suggest that Undercarboxylated osteocalcin may have other effects on skeletal muscle in addition to its insulin sensitizing effect. PMID: 27291707
  2. Uncarboxylated osteocalcin potentiates insulin secretion, inhibits Kv channels and increases [Ca(2+)]i. PMID: 27746193
  3. This rat model of complete loss of osteocalcin provides a platform for further understanding the role of osteocalcin in disease. PMID: 27483347
  4. gamma-Carboxylase inhibition prevents osteocalcin carboxylation and protects against diabetic cardiomyopathy, possibly through direct action on upregulated G protein-coupled receptor family C group 6 member A and indirectly via adiponectin. PMID: 27488359
  5. Bone Gla Protein PMID: 25185647
  6. In primary adipocytes, both carboxylated and uncarboxylated osteocalcin increased basal and insulin-stimulated glucose transport. PMID: 24554534
  7. The physiological changes associated with estrous cycle stage were not sufficient to cause a detectable difference in carboxylated or undercarboxylated osteocalcin concentrations in this study. PMID: 23817840
  8. Osteocalcin (OC)-containing neurons are distributed throughout the cerebellar nuclei; OC may play a role in modulating the neuroprotective function of osteopontin. PMID: 22552891
  9. warfarin impaired the carboxylation of osteocalcin in rats. Factor Xa inhibitor edoxaban at or higher doses than needed for an antithrombotic effect sustained the circulating Gla-osteocalcin level. PMID: 22999414
  10. results suggest that under some physiological conditions the oncoprotein MDM2 may cooperate with p53 to regulate the osteocalcin gene during osteoblastic differentiation. PMID: 22405968
  11. These data are strongly in support of Sp1 as an essential transcription factor required for Osx recruitment and transactivation of the OCN promoter. PMID: 21820092
  12. purified Bone Gla Protein (BGP) resulted in stabilization of hypoxia-inducible factor 1alpha (HIF-1alpha) in chondrocytes and vascular smooth muscle cells PMID: 21757657
  13. The mechanism of high glucose induced calcification in vascular smooth muscle cells may be due to the increased expression of cbfalpha-1 and OC. PMID: 21302441
  14. functional link between vitamin D-dependent bone tissue-specific transcription and histone acetylation at osteocalcin locus PMID: 11893738
  15. the VDRE in the distal region of the OC gene promoter is refractory to binding of the VDR-RXR complex when organized in a nucleosomal context PMID: 11964167
  16. deltaEF1 suppresses expression of the endogenous osteocalcin gene PMID: 12193549
  17. acetylation of histones H3 and H4 is functionally coupled to the chromatin remodeling events that mediate the developmental induction of osteocalcin gene transcription in bone cells PMID: 12554783
  18. Type I collagen promotes the activity of dentin formation by dental pulp cells by down-regulating Dmp-1 gene expression and up-regulating osteocalcin gene expression. PMID: 12647294
  19. A human vitamin D receptor-glucocorticoid receptor DNA-binding domain chimera is functional on rat osteocalcin vitamin D-responsive element with only conservative change of lys-49 to arg, and of negatively charged glu-53 to basic amino acid (lys or arg). PMID: 12960019
  20. Data show that in osteoblastic cells, the vitamin D receptor interacts directly with Runx2, and that this interaction contributes significantly to vitamin D3-dependent enhancement of the osteocalcin promoter. PMID: 15456860
  21. Results describe gene regulation by Dlx3 in relation to that of Msx2 and Dlx5 during osteoblast differentiation. PMID: 15456894
  22. Ocn is a Nurr1 target gene, which positions Nurr1 in the core of transcriptional factors regulating osteoblastic gene expression PMID: 15485875
  23. OC-IR nerve fibers in the circumvallate papilla mainly originated from the petrosal ganglion. PMID: 15621021
  24. Osteonectin (ON) and osteocalcin (OC) was used as osteoblast markersand assessed using an indirect immunoperoxidase. technique. PMID: 16443258
  25. CEBP-beta-dependent recruitment of SWI/SNF activity is required for chromatin remodeling and transcriptional activity of the bone-specific osteocalcin gene PMID: 16772287
  26. specific protein-DNA and protein-protein interactions that occur within the context of the OC gene promoter in osteoblastic cells stabilize the preferential association of the VDR-SRC-1 complex PMID: 17218095
  27. These results support a model where VDR preferentially recruits SRC-1 to enhance bone-specific OC gene transcription. PMID: 17786964
  28. These data suggest that long-term reduction in bone OC levels may induce the formation of immature bone, which is easily resorbed with changes in bone metabolism such as ovariectomy, and that OC may be one of the factors affecting bone turnover. PMID: 17968486
  29. TFIIA gamma together with ATF4 and Runx2 stimulates osteocalcin promoter activity and endogenous mRNA expression. PMID: 18171674
  30. Biomineralization followed secretion of osteocalcin, which may reflect early osteoblastic differentiation of cultured mesenchymal stem cells under osteoinductive conditions. PMID: 19191495
  31. The Notch-responsive Hes-1 protein is capable of repressing osteocalcin gene transcription in osteoblastic cells through an E-box in the proximal promoter. PMID: 19670267

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Osteocalcin/matrix Gla protein family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*