Recombinant Rat Osteocalcin (Bglap)

In Stock
Code CSB-EP002682RA
Abbreviation Recombinant Rat Bglap protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Bglap; Bglap2; Osteocalcin; Bone Gla protein; BGP; Gamma-carboxyglutamic acid-containing protein
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
50-99aa
Target Protein Sequence
YLNNGLGAPAPYPDPLEPHREVCELNPNCDELADHIGFQDAYKRIYGTTV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.6kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Rat Osteocalcin (Bglap) is expressed in E. coli and includes an N-terminal GST tag that makes purification more straightforward. The protein contains the full length of mature osteocalcin—specifically the 50-99 amino acid region. SDS-PAGE analysis confirms purity levels above 90%, suggesting this is a reliable reagent for research work. Endotoxin levels are kept low, which appears to make it suitable for different experimental approaches.

Osteocalcin, sometimes called bone gamma-carboxyglutamic acid-containing protein, seems to play a central role in how bones metabolize and mineralize. Osteoblasts produce this protein, and it likely helps regulate bone formation and calcium ion balance. Many researchers study osteocalcin as a marker of bone turnover, making it an attractive target for investigations into bone health and metabolic diseases.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Antibody Development and Validation

This recombinant rat osteocalcin may work well as an immunogen for creating polyclonal or monoclonal antibodies that target rat osteocalcin specifically. The N-terminal GST tag should help with purification and attachment during immunization procedures. The >90% purity probably reduces unwanted cross-reactions with other proteins when making antibodies. Researchers can then test these antibodies using the same recombinant protein in ELISA, Western blot, and similar immunoassays.

2. GST Pull-Down Assays for Protein-Protein Interactions

The N-terminal GST tag allows researchers to use this protein directly in GST pull-down experiments to find possible binding partners of rat osteocalcin. Scientists can attach the protein to glutathione-sepharose beads and mix it with cell lysates or purified protein collections. This method might reveal how osteocalcin interacts with other molecules in bone metabolism pathways. The high purity should reduce background noise from contaminating proteins.

3. Competitive Binding Studies and ELISA Development

This recombinant protein could function as a standard or competitor in enzyme-linked immunosorbent assays focused on osteocalcin research. The known concentration and high purity make it potentially useful for creating standard curves in quantitative ELISA protocols. Researchers might also use it to test how specific existing anti-osteocalcin antibodies really are through competitive inhibition experiments. If needed, the GST tag provides a way to orient the protein properly on ELISA plates.

4. Biochemical Characterization and Stability Studies

The purified recombinant rat osteocalcin opens up possibilities for detailed biochemical analysis—things like confirming molecular weight, testing thermal stability, and checking pH tolerance. Scientists can examine how the protein behaves in different buffer conditions and storage situations. The high purity level should allow for precise spectroscopic measurements and biophysical analysis. These investigations may provide basic data that helps researchers understand osteocalcin's properties in various research settings.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.
Gene References into Functions
  1. These data suggest that Undercarboxylated osteocalcin may have other effects on skeletal muscle in addition to its insulin sensitizing effect. PMID: 27291707
  2. Uncarboxylated osteocalcin potentiates insulin secretion, inhibits Kv channels and increases [Ca(2+)]i. PMID: 27746193
  3. This rat model of complete loss of osteocalcin provides a platform for further understanding the role of osteocalcin in disease. PMID: 27483347
  4. gamma-Carboxylase inhibition prevents osteocalcin carboxylation and protects against diabetic cardiomyopathy, possibly through direct action on upregulated G protein-coupled receptor family C group 6 member A and indirectly via adiponectin. PMID: 27488359
  5. Bone Gla Protein PMID: 25185647
  6. In primary adipocytes, both carboxylated and uncarboxylated osteocalcin increased basal and insulin-stimulated glucose transport. PMID: 24554534
  7. The physiological changes associated with estrous cycle stage were not sufficient to cause a detectable difference in carboxylated or undercarboxylated osteocalcin concentrations in this study. PMID: 23817840
  8. Osteocalcin (OC)-containing neurons are distributed throughout the cerebellar nuclei; OC may play a role in modulating the neuroprotective function of osteopontin. PMID: 22552891
  9. warfarin impaired the carboxylation of osteocalcin in rats. Factor Xa inhibitor edoxaban at or higher doses than needed for an antithrombotic effect sustained the circulating Gla-osteocalcin level. PMID: 22999414
  10. results suggest that under some physiological conditions the oncoprotein MDM2 may cooperate with p53 to regulate the osteocalcin gene during osteoblastic differentiation. PMID: 22405968
  11. These data are strongly in support of Sp1 as an essential transcription factor required for Osx recruitment and transactivation of the OCN promoter. PMID: 21820092
  12. purified Bone Gla Protein (BGP) resulted in stabilization of hypoxia-inducible factor 1alpha (HIF-1alpha) in chondrocytes and vascular smooth muscle cells PMID: 21757657
  13. The mechanism of high glucose induced calcification in vascular smooth muscle cells may be due to the increased expression of cbfalpha-1 and OC. PMID: 21302441
  14. functional link between vitamin D-dependent bone tissue-specific transcription and histone acetylation at osteocalcin locus PMID: 11893738
  15. the VDRE in the distal region of the OC gene promoter is refractory to binding of the VDR-RXR complex when organized in a nucleosomal context PMID: 11964167
  16. deltaEF1 suppresses expression of the endogenous osteocalcin gene PMID: 12193549
  17. acetylation of histones H3 and H4 is functionally coupled to the chromatin remodeling events that mediate the developmental induction of osteocalcin gene transcription in bone cells PMID: 12554783
  18. Type I collagen promotes the activity of dentin formation by dental pulp cells by down-regulating Dmp-1 gene expression and up-regulating osteocalcin gene expression. PMID: 12647294
  19. A human vitamin D receptor-glucocorticoid receptor DNA-binding domain chimera is functional on rat osteocalcin vitamin D-responsive element with only conservative change of lys-49 to arg, and of negatively charged glu-53 to basic amino acid (lys or arg). PMID: 12960019
  20. Data show that in osteoblastic cells, the vitamin D receptor interacts directly with Runx2, and that this interaction contributes significantly to vitamin D3-dependent enhancement of the osteocalcin promoter. PMID: 15456860
  21. Results describe gene regulation by Dlx3 in relation to that of Msx2 and Dlx5 during osteoblast differentiation. PMID: 15456894
  22. Ocn is a Nurr1 target gene, which positions Nurr1 in the core of transcriptional factors regulating osteoblastic gene expression PMID: 15485875
  23. OC-IR nerve fibers in the circumvallate papilla mainly originated from the petrosal ganglion. PMID: 15621021
  24. Osteonectin (ON) and osteocalcin (OC) was used as osteoblast markersand assessed using an indirect immunoperoxidase. technique. PMID: 16443258
  25. CEBP-beta-dependent recruitment of SWI/SNF activity is required for chromatin remodeling and transcriptional activity of the bone-specific osteocalcin gene PMID: 16772287
  26. specific protein-DNA and protein-protein interactions that occur within the context of the OC gene promoter in osteoblastic cells stabilize the preferential association of the VDR-SRC-1 complex PMID: 17218095
  27. These results support a model where VDR preferentially recruits SRC-1 to enhance bone-specific OC gene transcription. PMID: 17786964
  28. These data suggest that long-term reduction in bone OC levels may induce the formation of immature bone, which is easily resorbed with changes in bone metabolism such as ovariectomy, and that OC may be one of the factors affecting bone turnover. PMID: 17968486
  29. TFIIA gamma together with ATF4 and Runx2 stimulates osteocalcin promoter activity and endogenous mRNA expression. PMID: 18171674
  30. Biomineralization followed secretion of osteocalcin, which may reflect early osteoblastic differentiation of cultured mesenchymal stem cells under osteoinductive conditions. PMID: 19191495
  31. The Notch-responsive Hes-1 protein is capable of repressing osteocalcin gene transcription in osteoblastic cells through an E-box in the proximal promoter. PMID: 19670267

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Osteocalcin/matrix Gla protein family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*