Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

S100a6

Uniprot No.

P05964

Research Area

Others

Species

Rattus norvegicus (Rat)

Source

E.coli

Expression Region

1-89aa

Target Protein Sequence

MACPLDQAIGLLVAIFHKYSGKEGDKHTLSKKELKELIQKELTIGAKLQDAEIARLMDDLDRNKDQEVNFQEYVAFLGALALIYNEALK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

13.7 kDa

Protein Length

Full Length

Tag Info

N-terminal 10xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The creation of the recombinant Rat S100a6 protein is achieved through genetic engineering techniques. A specific DNA sequence coding for the Rat S100a6 protein (1-89aa) is integrated into an expression vector, which serves as a carrier for gene expression. This vector is then introduced into e.coli cells, which are cultured to facilitate the expression of the desired protein. The protein is fused with a N-terminal 10xHis tag. The recombinant Rat S100a6 protein is subsequently purified using affinity purification, resulting in a purity level exceeding 90%, as verified by SDS-PAGE analysis.

Target Background

Function

May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative.

Gene References into Functions

S100A6 overexpression by ultrasound-targeted microbubble destruction helps ameliorate myocardial ischemia-reperfusion, resulting in lower mortality and improved left ventricular systolic function post-ischemia-reperfusion via attenuation of apoptosis, reduction in cardiac hypertrophy, and reduced infarct size PMID: 28174168
The level of S100A6 mRNA was very low and did not change during long-term posttetanic potentiation in the hippocampus. PMID: 20027335
role in long term regulation of ion transport PMID: 12000747
role in modulating pulmonary fibroblast proliferation and cytoskeletal organization in an intact cell PMID: 12577318
may function as a global negative modulator of differentiated cardiac gene expression PMID: 15652358

Hide All

Subcellular Location

Nucleus envelope. Cytoplasm. Cell membrane; Peripheral membrane protein; Cytoplasmic side.

Protein Families

S-100 family

Database Links

KEGG: rno:85247

STRING: 10116.ENSRNOP00000015612

UniGene: Rn.3233

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP020634RA
Abbreviation	Recombinant Rat S100a6 protein
MSDS	MSDS Datasheet
Size	$256
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Rat Protein S100-A6 (S100a6)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage