Recombinant Rat Regenerating islet-derived protein 3-beta (Reg3b)

Code CSB-EP326510RA
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Reg3b
Uniprot No.
Research Area
Others
Alternative Names
Reg3b; Pap; Pap1; Reg2; Regenerating islet-derived protein 3-beta; REG-3-beta; Pancreatitis-associated protein 1; Peptide 23; REG-2; Regenerating islet-derived protein III-beta; Reg III-beta) [Cleaved into: Regenerating islet-derived protein 3-beta 16.5 kDa form; Regenerating islet-derived protein 3-beta 15 kDa form]
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
27-175aa
Target Protein Sequence
EDSPKKIPSARISCPKGSQAYGSYCYALFQIPQTWFDAELACQKRPEGHLVSVLNVAEASFLASMVKNTGNSYQYTWIGLHDPTLGGEPNGGGWEWSNNDIMNYVNWERNPSTALDRGFCGSLSRSSGFLRWRDTTCEVKLPYVCKFTG
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
20.6kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Bactericidal C-type lectin which acts against several intestinal Gram-positive bacteria and Gram-negative bacteria. Lacks antibacterial activity against S.typhimurium. May play a role in protection against infection with S.enteritidis by inhibiting its translocation from the gut lumen into intestinal tissues and further extraintestinal tissues.
Gene References into Functions
  1. These results demonstrate a direct effect of INGAP-PP on the liver acting through P-Akt signaling pathway. INGAP-PP enhances liver glucose metabolism and deposit and reduces its production/output, thereby contributing to maintain normal glucose homeostasis. PMID: 29305881
  2. Reg3beta-dependent accumulation of macrophages in the ischemic heart has a role in myocardial healing PMID: 25751817
  3. Alox15 mRNA levels were 4 times higher in iron-deficient than in iron-adequate pancreas and that Reg1a, Reg3a, and Reg3b mRNA levels were 17-36 times higher in iron-overloaded pancreas. PMID: 24465846
  4. Regenerating 1 and 3b gene expression in the pancreas of type 2 diabetic Goto-Kakizaki (GK) rats PMID: 24587207
  5. Findings suggest that islet neogenesis-associated protein (INGAP) exerts a positive modulatory effect on beta-cell mass and its secretory function in fetal and neonatal rats, thus becoming a new component in the multifactorial regulation of such processes. PMID: 23303201
  6. After duodenal-jejunal bypass, the level of Reg3alpha and -3beta were not changed in bypassed duodenum in morbidly obese Zucker fatty rats. PMID: 23370676
  7. In older animals, there is depressed PAP expression related to a blunted inflammatory response in acute pancreatitis which is associated with worsened bacterial infiltration and higher C-reactive protein level PMID: 22807607
  8. PAP-I and PAP-III induction in non-gamma- aminobutyric acid (GABA)ergic neurons might protect these neurons against damage following seizure. PMID: 21093549
  9. Letter: aggregation status of PAP1 and PAP2 could change their role in regulating the inflammation in acute pancreatitis. PMID: 21926556
  10. Pancreatitis-associated protein I could play a role similar to that of IL-10 in epithelial cells. PMID: 16517747
  11. Thus, PAP family members may have an anti-inflammatory role, and this may contribute to the protection of injured neurons. PMID: 19351265
  12. There is a tight spatial and temporal association between pre-inflammatory changes or inflammation and PAP-expression PMID: 15100001
  13. Sepsis resulted in an up-regulation of PAP-1 gene expression and increase in its protein level in pancreas. The functional role of PAP-1 production in sepsis needs further investigation. PMID: 15211109
  14. These results suggest that Reg family members would be new mediators among injured neurons and glial cells, and may play pivotal roles during nerve regeneration. PMID: 15896308
  15. pancreatitis-associated protein-I is implicated in the abnormal sensation in cystitis. PMID: 18295254
  16. The Reg/PAP family, which was found to show dramatically increasing gene expressions by DNA microarray analysis, was suspected to play an important role in myocarditis. PMID: 18774541
  17. Results indicated that the mechanism of PAP1 action involves the activation of the mitogen-activated protein kinase superfamily. PMID: 19434369
  18. PAP1 mrna expression was higher in vena cava versus thoracic aorta. PMID: 19571575
  19. Results indicate that PAP-1 may be a defensive gene for oxidative stress-induced cell death of pancreatic acinar cells. PMID: 19723102

Show More

Hide All

Involvement in disease
Overexpressed during the acute phase of pancreatitis.
Subcellular Location
Secreted. Note=Found in the apical region of pancreatic acinar cells.
Tissue Specificity
Constitutively expressed in intestine.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*