Recombinant Rat Sodium channel protein type 10 subunit alpha (Scn10a), partial

In Stock
Code CSB-EP737100RA
Abbreviation Recombinant Rat Scn10a protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Neuroscience
Alternative Names
Peripheral nerve sodium channel 3;Sensory neuron sodium channel;Sodium channel protein type X subunit alpha;Voltage-gated sodium channel subunit alpha Nav1.8
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
1-125aa
Target Protein Sequence
MELPFASVGTTNFRRFTPESLAEIEKQIAAHRAAKKARTKHRGQEDKGEKPRPQLDLKACNQLPKFYGELPAELVGEPLEDLDPFYSTHRTFMVLNKSRTISRFSATWALWLFSPFNLIRRTAIK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
21.3 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Tetrodotoxin-resistant channel that mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which sodium ions may pass in accordance with their electrochemical gradient. Plays a role in neuropathic pain mechanisms.
Gene References into Functions
  1. Treatment of AOAA markedly suppressed expression of NaV1.7 and NaV1.8 in DRGs of lumbar disc herniation (LDH) rats. These data suggest that targeting the CBS-H2S signaling at the DRG level might represent a novel therapeutic strategy for chronic pain relief in patients with LDH. PMID: 27905525
  2. Study found that trigeminal ganglion in rats subjected to an infraorbital nerve-chronic constriction injury showed upregulation of Nav1.3 and downregulation of Nav1.7, Nav1.8, and Nav1.9 messenger RNA and protein levels. Findings suggest that voltage-gated sodium channels may participate in the regulation of trigeminal neuralgia. PMID: 27327156
  3. This study demonstrated the modulation of Nav1.8 by LPA in DRG neurons, and that this probably underlies the peripheral mechanism by which bone cancer pain is induced. PMID: 27631681
  4. investigated whether the aberrant expression of Nav1.8 in dorsal root ganglia contributes to generation of pain induced by scorpion stings PMID: 26764239
  5. Up-regulation of Nav1.8 in nociceptive neurons contributes to persistent pain regulated by SDF1-CXCR4 signaling. PMID: 26597700
  6. The study demonstrates that positive shift of Nav1.8 current inactivation curve in injured neurons causes neuropathic pain following chronic constriction injury. PMID: 26005195
  7. functional upregulation of Nav1.8 channels on the membrane of DRG neurons contributes to the development of cancer-induced bone pain PMID: 25503076
  8. A novel splice variant of SCN10A lacking exon 11 was found in human but not detected in mouse or rat. PMID: 24763188
  9. Sodium channels Na(V)1.8 and Na(V)1.9 in primary sensory neurons played distinct roles in complete Freund's adjuvant-induced inflammatory pain.[Na(V)1.8, Na(V)1.0] PMID: 21572961
  10. The results of this study indicate that histamine increases Nav1.8 expression in primary afferent neurons via H2 receptor-mediated pathway and thereby contributes to neuropathic pain PMID: 24990156
  11. PKC-NF-kappaB are involved in CCL2-induced elevation of Nav1.8 current density by promoting the phosphorylation of Nav1.8 and its expression. PMID: 24724624
  12. This study demonistrated that Na(v)1.8 in controlling the excitability of Abeta-fibers and its potential contribution to the development of mechanical allodynia under persistent inflammation. PMID: 24606981
  13. NaV1.8 are expressed in large and small diameter sensory afferent neurons. PMID: 23064159
  14. Neonatal colonic inflammation up regulates NaV1.7 and NaV1.8 expression and potentiates total Na+ channel current density in colon-specific dorsal root ganglion neurons in adult rats with visceral hypersensitivity. PMID: 23449670
  15. The up-regulation of mRNA and protein levels of Nav1.8 suggested it's potential involvement in the development and maintenance of bone cancer pain. PMID: 22342308
  16. Neonatal maternal deprivation remarkably enhanced expression of Na(V)1.8 at protein levels but not at mRNA levels in colon-related dorsal root ganglion neurons. PMID: 23139220
  17. Data suggest that targeting the Nav1.8 sodium channel on joint nociceptors could therefore be useful for the treatment of osteoarthritis (OA) pain. PMID: 22225591
  18. Spinal activation of Nav1.8 mediates induction and/or maintenance of capsaicin- and peripheral ischemia-induced mechanical allodynia and thermal hyperalgesia. PMID: 22127815
  19. The beta-subunits differentially regulate the expression and gating of Nav1.8 and Nav1.6 in dorsal root ganglion neurons. PMID: 21562192
  20. targeted delivery of agents that interfere with axonal NaV1.8 mRNA may represent effective neuropathic pain treatments. PMID: 21965668
  21. The concomitant axonal accumulation of NaV1.8 mRNA may play a role in the pathogenesis of neuropathic pain. PMID: 19320998
  22. The beta3 subunit promotes surface expression of Na(v)1.8 by masking its endoplasmic reticulum (ER)-retention/retrieval signal. PMID: 18782866
  23. Time course study of dental pulp inflammation indicated that differences in relative mRNA expression levels of Nav 1.8 were correlated with the severity of inflammation. PMID: 21276017
  24. The pain caused by molar extraction is related to the up-regulation of expressions of sodium channels protein Nav1.8 and Nav1.9 mRNA. PMID: 19575990
  25. Findings suggest that Nav1.8 plays a role in the development and maintenance of bone cancer pain. PMID: 20482896
  26. the trafficking of Na(v)1.8 is regulated by prostaglandin E(2) through the protein kinase A signaling pathway. PMID: 20028484
  27. Data describe alternative splicing in a NAGNAG tandem acceptor in SCN10A that results in isoforms including/lacking glutamine 1030, which is conserved among rodents and humans but its alternative usage apparently occurs with species-specific abundance. PMID: 19953341
  28. Annexin II light chain (p11) is a regulatory factor that facilitates the expression of Na(V)1.8. p11 binds directly to the amino terminus of Na(V)1.8 and promotes the translocation of Na(V)1.8 to the plasma membrane, producing functional channels PMID: 12050667
  29. conclude from mutation and electrophyiology studies that the two Na(+) channels, rNa(v)1.7 and rNa(v)1.8 (Scn10a gene), may have different endoplasmic reticulum processing signals. PMID: 14960304
  30. functional behavior of Nav1.8 will vary depending on the type of beta-subunit expressed under normal and disease states PMID: 15178439
  31. Nav 1.8 is involved in frank nerve injury & inflammatory pain as compared to acute, post-operative or chemotherapy-induced neuropathic pain states. PMID: 16545521
  32. use-dependent reduction of Na(v)1.8 current in these two DRG subpopulations contributes to functional differences between these two neuronal populations PMID: 17108087
  33. data present strong evidence for a specialized role of Na(v)1.8 in nociceptors as the critical molecule for the perception of cold pain and pain in the cold PMID: 17568746
  34. Na(V)1.8 plays a role in the maintenance of chronic inflammatory pain several weeks after the initial insult PMID: 17950013
  35. Low concentrations of tetrodotoxin interact with tetrodotoxin-resistant voltage-gated sodium channels. PMID: 18552876
  36. This study results provide evidence for presynaptic expression of functional TTX-R Na(+) channels that may be important for shaping presynaptic action potentials and regulating transmitter release at the first sensory synapse. PMID: 19162133
  37. Chimeras containing the N-terminal half of Na(v)1.8 exhibited a large response similar to wild-type Na(v)1.8, indicating that the region conferring high sensitivity to ciguatoxin action is located in the D1 or D2 domains. PMID: 19164297
  38. trigeminal ganglion sodium channel transcripts mature in steps that are specific for each transcript in development PMID: 19269275
  39. These findings reveal that Pdzd2 and p11 play collaborative roles in regulation of Na(V)1.8 expression in sensory neurons. PMID: 19607921

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
Sodium channel (TC 1.A.1.10) family, Nav1.8/SCN10A subfamily
Tissue Specificity
Expressed in dorsal root ganglia, trigeminal ganglia, nodose ganglia and sciatic nerve.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*