Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Sult1a1

Uniprot No.

P17988

Research Area

Signal Transduction

Alternative Names

Sult1a1; St1a1; Sulfotransferase 1A1; ST1A1; EC 2.8.2.1; Aryl sulfotransferase; Aryl sulfotransferase IV; ASTIV; Minoxidil sulfotransferase; Mx-ST; PST-1; Phenol sulfotransferase; Sulfokinase; Tyrosine-ester sulfotransferase

Species

Rattus norvegicus (Rat)

Source

E.coli

Expression Region

1-291aa

Target Protein Sequence

MEFSRPPLVHVKGIPLIKYFAETIGPLQNFTAWPDDLLISTYPKSGTTWMSEILDMIYQGGKLEKCGRAPIYARVPFLEFKCPGVPSGLETLEETPAPRLLKTHLPLSLLPQSLLDQKVKVIYIARNAKDVVVSYYNFYNMAKLHPDPGTWDSFLENFMDGEVSYGSWYQHVKEWWELRHTHPVLYLFYEDIKENPKREIKKILEFLGRSLPEETVDSIVHHTSFKKMKENCMTNYTTIPTEIMDHNVSPFMRKGTTGDWKNTFTVAQNERFDAHYAKTMTDCDFKFRCEL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

53.9kDa

Protein Length

Full Length

Tag Info

N-terminal 10XHis-SUMO-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The region for expressing recombinant Rat Sult1a1 contains amino acids 1-291. The calculated molecular weight for this Sult1a1 protein is 53.9 kDa. Expression of this Sult1a1 protein is conducted in e.coli. The Sult1a1 coding gene included the N-terminal 10XHis-SUMO tag and C-terminal Myc tag, which simplifies the detection and purification processes of the recombinant Sult1a1 protein in following stages of expression and purification.

The rat sulfotransferase 1A1 (Sult1a1) is an enzyme belonging to the sulfotransferase family, which is involved in the phase II detoxification process of xenobiotics and endogenous compounds. Sult1a1 catalyzes the transfer of a sulfate group from the universal sulfate donor, 3'-phosphoadenosine-5'-phosphosulfate (PAPS), to various substrates, including hormones, drugs, and xenobiotics, facilitating their elimination from the body. This enzyme is primarily expressed in the liver, where it participates in the metabolism of a diverse range of compounds, including steroids, phenols, and neurotransmitters. Understanding the function of Sult1a1 is crucial for comprehending the mechanisms underlying detoxification processes and drug metabolism in rodents. Research in this area contributes to advancements in drug development, toxicology, and the understanding of metabolic pathways in the context of physiological and pharmacological processes in rats.

Target Background

Function

Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of a wide variety of acceptor molecules bearing a hydroxyl or an amine groupe. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Displays broad substrate specificity for small phenolic compounds. Plays an important roles in the sulfonation of endogenous molecules such as steroid hormones and 3,3'-diiodothyronin. Mediates the sulfate conjugation of a variety of xenobiotics, including the drugs acetaminophen and minoxidil. Mediates also the metabolic activation of carcinogenic N-hydroxyarylamines leading to highly reactive intermediates capable of forming DNA adducts, potentially resulting in mutagenesis.

Gene References into Functions

SULT1A1 is responsible for bioactivation of food genotoxicants 5-hydroxymethylfurfural and furfuryl alcohol. PMID: 25370010
Higher SULT1A1 levels were observed in rats as well as in humans exposed to high altitude, when compared to sea-level controls PMID: 26022216
Results suggest that the physiological functions of SULT1A1 in different brain regions can be affected by methamphetamine. PMID: 23026138
Data suggest that Sult1a1 and Sult2a1 can be induced in small intestinal mucosa by dietary factors (here, by various levels of caffeine); induction is gender specific and organ specific. Consumption of caffeine may enhance xenobiotic detoxification. PMID: 21721019
mechanistic studies on enzyme activity of purified recombinant Sult1a1 and Sult1a1 in viable liver slices after treatment with the same oxidants [1,1'-azobis(N,N-dimethylformamide); tert-butylhydroperoxide] and the same substrate (7-hydroxycoumarin) PMID: 22041107
Stp1 is important for appropriate regulation of Stk1 function, hemolysin activity, autolysis, and GBS virulence PMID: 22081606
there is a possible Cys modification mechanism for stress regulation of SULT1A1 PMID: 15351727

Hide All

Subcellular Location

Cytoplasm.

Protein Families

Sulfotransferase 1 family

Tissue Specificity

Liver, kidney, heart and colon.

Database Links

KEGG: rno:83783

STRING: 10116.ENSRNOP00000026186

UniGene: Rn.1507

Code	CSB-EP022933RA
Abbreviation	Recombinant Rat Sult1a1 protein
MSDS	MSDS Datasheet
Size	US$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP022933RA could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Sult1a1. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP022933RA could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Sult1a1.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Rat Sulfotransferase 1A1 (Sult1a1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage