Recombinant Rat Sulfotransferase 1A1(Sult1a1)

^{In Stock}

Code	CSB-EP022933RA
Size	US$2466Purchase it in Cusabio online store (only available for customers from the US)
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP022933RA could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Sult1a1. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP022933RA could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Sult1a1.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Target Data

Product Details

Purity	Greater than 90% as determined by SDS-PAGE.
Target Names	Sult1a1
Uniprot No.	P17988
Research Area	Signal Transduction
Alternative Names	Sult1a1; St1a1; Sulfotransferase 1A1; ST1A1; EC 2.8.2.1; Aryl sulfotransferase; Aryl sulfotransferase IV; ASTIV; Minoxidil sulfotransferase; Mx-ST; PST-1; Phenol sulfotransferase; Sulfokinase; Tyrosine-ester sulfotransferase
Species	Rattus norvegicus (Rat)
Source	E.coli
Expression Region	1-291aa
Target Protein Sequence	MEFSRPPLVHVKGIPLIKYFAETIGPLQNFTAWPDDLLISTYPKSGTTWMSEILDMIYQGGKLEKCGRAPIYARVPFLEFKCPGVPSGLETLEETPAPRLLKTHLPLSLLPQSLLDQKVKVIYIARNAKDVVVSYYNFYNMAKLHPDPGTWDSFLENFMDGEVSYGSWYQHVKEWWELRHTHPVLYLFYEDIKENPKREIKKILEFLGRSLPEETVDSIVHHTSFKKMKENCMTNYTTIPTEIMDHNVSPFMRKGTTGDWKNTFTVAQNERFDAHYAKTMTDCDFKFRCEL Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight	53.9kDa
Protein Length	Full Length
Tag Info	N-terminal 10XHis-SUMO-tagged and C-terminal Myc-tagged
Form	Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA	Please contact us to get it.

Target Data

Function	Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. Has also estrogen sulfotransferase activity. responsible for the sulfonation and activation of minoxidil. Is Mediates the metabolic activation of carcinogenic N-hydroxyarylamines to DNA binding products and could so participate as modulating factor of cancer risk.
Gene References into Functions	SULT1A1 is responsible for bioactivation of food genotoxicants 5-hydroxymethylfurfural and furfuryl alcohol. PMID: 25370010 Higher SULT1A1 levels were observed in rats as well as in humans exposed to high altitude, when compared to sea-level controls PMID: 26022216 Results suggest that the physiological functions of SULT1A1 in different brain regions can be affected by methamphetamine. PMID: 23026138 Data suggest that Sult1a1 and Sult2a1 can be induced in small intestinal mucosa by dietary factors (here, by various levels of caffeine); induction is gender specific and organ specific. Consumption of caffeine may enhance xenobiotic detoxification. PMID: 21721019 mechanistic studies on enzyme activity of purified recombinant Sult1a1 and Sult1a1 in viable liver slices after treatment with the same oxidants [1,1'-azobis(N,N-dimethylformamide); tert-butylhydroperoxide] and the same substrate (7-hydroxycoumarin) PMID: 22041107 Stp1 is important for appropriate regulation of Stk1 function, hemolysin activity, autolysis, and GBS virulence PMID: 22081606 there is a possible Cys modification mechanism for stress regulation of SULT1A1 PMID: 15351727 Show More Hide All
Subcellular Location	Cytoplasm
Protein Families	Sulfotransferase 1 family
Tissue Specificity	Liver, kidney, heart and colon.
Database Links	KEGG: rno:83783 STRING: 10116.ENSRNOP00000026186 UniGene: Rn.1507