Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-EP022933RA |
| Product Type | Recombinant Protein |
| Size |
US$2466Purchase it in Cusabio online store (Shop online in the US. Customers outside the US, please order from local distributors.) |
| Uniprot No. | P17988 |
| Relevance | Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. Has also estrogen sulfotransferase activity. responsible for the sulfonation and activation of minoxidil. Is Mediates the metabolic activation of carcinogenic N-hydroxyarylamines to DNA binding products and could so participate as modulating factor of cancer risk. |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Alias | Aryl sulfotransferase Aryl sulfotransferase IV |
| Species | Rattus norvegicus (Rat) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | MEFSRPPLVHVKGIPLIKYFAETIGPLQNFTAWPDDLLISTYPKSGTTWMSEILDMIYQGGKLEKCGRAPIYARVPFLEFKCPGVPSGLETLEETPAPRLLKTHLPLSLLPQSLLDQKVKVIYIARNAKDVVVSYYNFYNMAKLHPDPGTWDSFLENFMDGEVSYGSWYQHVKEWWELRHTHPVLYLFYEDIKENPKREIKKILEFLGRSLPEETVDSIVHHTSFKKMKENCMTNYTTIPTEIMDHNVSPFMRKGTTGDWKNTFTVAQNERFDAHYAKTMTDCDFKFRCEL |
| Research Area | Signal Transduction |
| Source | E.coli |
| Gene Names | Sult1a1 |
| Protein Names | Recommended name: Sulfotransferase 1A1 Short name= ST1A1 EC= 2.8.2.1 Alternative name(s): Aryl sulfotransferase Aryl sulfotransferase IV Short name= ASTIV Minoxidil sulfotransferase Short name= Mx-ST PST-1 |
| Expression Region | 1-291aa |
| Tag Info | N-terminal 10XHis-SUMO-tagged and C-terminal Myc-tagged |
| Mol. Weight | 53.9kDa |
| Protein Description | Full Length |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. Has also estrogen sulfotransferase activity. responsible for the sulfonation and activation of minoxidil. Is Mediates the metabolic activation of carcinogenic N-hydroxyarylamines to DNA binding products and could so participate as modulating factor of cancer risk. |
| Subcellular Location | Cytoplasm |
| Protein Families | Sulfotransferase 1 family |
| Tissue Specificity | Liver, kidney, heart and colon. |
| Database Links |
KEGG: rno:83783 STRING: 10116.ENSRNOP00000026186 UniGene: Rn.1507 |
Sult1a1 Antibodies for Rattus norvegicus (Rat)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA022933ZA01RA | Sult1a1 Antibody | Rattus norvegicus | ELISA, WB (ensure identification of antigen) |
Sult1a1 Proteins for Rattus norvegicus (Rat)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP022933RA CSB-BP022933RA CSB-MP022933RA |
Recombinant Rat Sulfotransferase 1A1(Sult1a1) | Yeast Baculovirus Mammalian cell |
Recombinant Bovine Polymeric immunoglobulin receptor(PIGR),partial
Express system: E.coli
Species: Bos taurus (Bovine)
Recombinant Human Ornithine decarboxylase(ODC1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Bovine T-cell surface glycoprotein CD8 alpha chain(CD8A),partial
Express system: Yeast
Species: Bos taurus (Bovine)
Recombinant Human Pulmonary surfactant-associated protein D(SFTPD)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Dog Cholinesterase(BCHE)
Express system: E.coli
Species: Canis lupus familiaris (Dog) (Canis familiaris)
Recombinant Human Probable global transcription activator SNF2L2(SMARCA2),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Translationally-controlled tumor protein(Tpt1)
Express system: E.coli
Species: Mus musculus (Mouse)
