Recombinant Rat Sulfotransferase 1A1(Sult1a1)

In Stock
Code CSB-EP022933RA
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P17988
Relevance Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. Has also estrogen sulfotransferase activity. responsible for the sulfonation and activation of minoxidil. Is Mediates the metabolic activation of carcinogenic N-hydroxyarylamines to DNA binding products and could so participate as modulating factor of cancer risk.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP022933RA could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Sult1a1.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP022933RA could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Sult1a1.
Storage Buffer Tris-based buffer,50% glycerol
Alias Aryl sulfotransferase Aryl sulfotransferase IV
Species Rattus norvegicus (Rat)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MEFSRPPLVHVKGIPLIKYFAETIGPLQNFTAWPDDLLISTYPKSGTTWMSEILDMIYQGGKLEKCGRAPIYARVPFLEFKCPGVPSGLETLEETPAPRLLKTHLPLSLLPQSLLDQKVKVIYIARNAKDVVVSYYNFYNMAKLHPDPGTWDSFLENFMDGEVSYGSWYQHVKEWWELRHTHPVLYLFYEDIKENPKREIKKILEFLGRSLPEETVDSIVHHTSFKKMKENCMTNYTTIPTEIMDHNVSPFMRKGTTGDWKNTFTVAQNERFDAHYAKTMTDCDFKFRCEL
Research Area Signal Transduction
Source E.coli
Gene Names Sult1a1
Protein Names Recommended name: Sulfotransferase 1A1 Short name= ST1A1 EC= 2.8.2.1 Alternative name(s): Aryl sulfotransferase Aryl sulfotransferase IV Short name= ASTIV Minoxidil sulfotransferase Short name= Mx-ST PST-1
Expression Region 1-291aa
Tag Info N-terminal 10XHis-SUMO-tagged and C-terminal Myc-tagged
Mol. Weight 53.9kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of catecholamines, phenolic drugs and neurotransmitters. Has also estrogen sulfotransferase activity. responsible for the sulfonation and activation of minoxidil. Is Mediates the metabolic activation of carcinogenic N-hydroxyarylamines to DNA binding products and could so participate as modulating factor of cancer risk.
Subcellular Location Cytoplasm
Protein Families Sulfotransferase 1 family
Tissue Specificity Liver, kidney, heart and colon.
Database Links

KEGG: rno:83783

STRING: 10116.ENSRNOP00000026186

UniGene: Rn.1507

Related Products

Sult1a1 Antibodies

Sult1a1 Antibodies for Rattus norvegicus (Rat)

Sult1a1 Proteins

Sult1a1 Proteins for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.