Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Signal Transduction
Alternative Names
Sult1a1; St1a1; Sulfotransferase 1A1; ST1A1; EC 2.8.2.1; Aryl sulfotransferase; Aryl sulfotransferase IV; ASTIV; Minoxidil sulfotransferase; Mx-ST; PST-1; Phenol sulfotransferase; Sulfokinase; Tyrosine-ester sulfotransferase
Species
Rattus norvegicus (Rat)
Expression Region
1-291aa
Target Protein Sequence
MEFSRPPLVHVKGIPLIKYFAETIGPLQNFTAWPDDLLISTYPKSGTTWMSEILDMIYQGGKLEKCGRAPIYARVPFLEFKCPGVPSGLETLEETPAPRLLKTHLPLSLLPQSLLDQKVKVIYIARNAKDVVVSYYNFYNMAKLHPDPGTWDSFLENFMDGEVSYGSWYQHVKEWWELRHTHPVLYLFYEDIKENPKREIKKILEFLGRSLPEETVDSIVHHTSFKKMKENCMTNYTTIPTEIMDHNVSPFMRKGTTGDWKNTFTVAQNERFDAHYAKTMTDCDFKFRCEL
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 10XHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The region for expressing recombinant Rat Sult1a1 contains amino acids 1-291. The calculated molecular weight for this Sult1a1 protein is 53.9 kDa. Expression of this Sult1a1 protein is conducted in e.coli. The Sult1a1 coding gene included the N-terminal 10XHis-SUMO tag and C-terminal Myc tag, which simplifies the detection and purification processes of the recombinant Sult1a1 protein in following stages of expression and purification.
The rat sulfotransferase 1A1 (Sult1a1) is an enzyme belonging to the sulfotransferase family, which is involved in the phase II detoxification process of xenobiotics and endogenous compounds. Sult1a1 catalyzes the transfer of a sulfate group from the universal sulfate donor, 3'-phosphoadenosine-5'-phosphosulfate (PAPS), to various substrates, including hormones, drugs, and xenobiotics, facilitating their elimination from the body. This enzyme is primarily expressed in the liver, where it participates in the metabolism of a diverse range of compounds, including steroids, phenols, and neurotransmitters. Understanding the function of Sult1a1 is crucial for comprehending the mechanisms underlying detoxification processes and drug metabolism in rodents. Research in this area contributes to advancements in drug development, toxicology, and the understanding of metabolic pathways in the context of physiological and pharmacological processes in rats.
