Recombinant Rat Sulfotransferase 1A1 (Sult1a1)

In Stock
Code CSB-EP022933RA
Abbreviation Recombinant Rat Sult1a1 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP022933RA could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Sult1a1.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP022933RA could indicate that this peptide derived from E.coli-expressed Rattus norvegicus (Rat) Sult1a1.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Sult1a1
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Sult1a1; St1a1; Sulfotransferase 1A1; ST1A1; EC 2.8.2.1; Aryl sulfotransferase; Aryl sulfotransferase IV; ASTIV; Minoxidil sulfotransferase; Mx-ST; PST-1; Phenol sulfotransferase; Sulfokinase; Tyrosine-ester sulfotransferase
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
1-291aa
Target Protein Sequence
MEFSRPPLVHVKGIPLIKYFAETIGPLQNFTAWPDDLLISTYPKSGTTWMSEILDMIYQGGKLEKCGRAPIYARVPFLEFKCPGVPSGLETLEETPAPRLLKTHLPLSLLPQSLLDQKVKVIYIARNAKDVVVSYYNFYNMAKLHPDPGTWDSFLENFMDGEVSYGSWYQHVKEWWELRHTHPVLYLFYEDIKENPKREIKKILEFLGRSLPEETVDSIVHHTSFKKMKENCMTNYTTIPTEIMDHNVSPFMRKGTTGDWKNTFTVAQNERFDAHYAKTMTDCDFKFRCEL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
53.9kDa
Protein Length
Full Length
Tag Info
N-terminal 10XHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The region for expressing recombinant Rat Sult1a1 contains amino acids 1-291. The calculated molecular weight for this Sult1a1 protein is 53.9 kDa. Expression of this Sult1a1 protein is conducted in e.coli. The Sult1a1 coding gene included the N-terminal 10XHis-SUMO tag and C-terminal Myc tag, which simplifies the detection and purification processes of the recombinant Sult1a1 protein in following stages of expression and purification.

The rat sulfotransferase 1A1 (Sult1a1) is an enzyme belonging to the sulfotransferase family, which is involved in the phase II detoxification process of xenobiotics and endogenous compounds. Sult1a1 catalyzes the transfer of a sulfate group from the universal sulfate donor, 3'-phosphoadenosine-5'-phosphosulfate (PAPS), to various substrates, including hormones, drugs, and xenobiotics, facilitating their elimination from the body. This enzyme is primarily expressed in the liver, where it participates in the metabolism of a diverse range of compounds, including steroids, phenols, and neurotransmitters. Understanding the function of Sult1a1 is crucial for comprehending the mechanisms underlying detoxification processes and drug metabolism in rodents. Research in this area contributes to advancements in drug development, toxicology, and the understanding of metabolic pathways in the context of physiological and pharmacological processes in rats.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of a wide variety of acceptor molecules bearing a hydroxyl or an amine groupe. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Displays broad substrate specificity for small phenolic compounds. Plays an important roles in the sulfonation of endogenous molecules such as steroid hormones and 3,3'-diiodothyronin. Mediates the sulfate conjugation of a variety of xenobiotics, including the drugs acetaminophen and minoxidil. Mediates also the metabolic activation of carcinogenic N-hydroxyarylamines leading to highly reactive intermediates capable of forming DNA adducts, potentially resulting in mutagenesis.
Gene References into Functions
  1. SULT1A1 is responsible for bioactivation of food genotoxicants 5-hydroxymethylfurfural and furfuryl alcohol. PMID: 25370010
  2. Higher SULT1A1 levels were observed in rats as well as in humans exposed to high altitude, when compared to sea-level controls PMID: 26022216
  3. Results suggest that the physiological functions of SULT1A1 in different brain regions can be affected by methamphetamine. PMID: 23026138
  4. Data suggest that Sult1a1 and Sult2a1 can be induced in small intestinal mucosa by dietary factors (here, by various levels of caffeine); induction is gender specific and organ specific. Consumption of caffeine may enhance xenobiotic detoxification. PMID: 21721019
  5. mechanistic studies on enzyme activity of purified recombinant Sult1a1 and Sult1a1 in viable liver slices after treatment with the same oxidants [1,1'-azobis(N,N-dimethylformamide); tert-butylhydroperoxide] and the same substrate (7-hydroxycoumarin) PMID: 22041107
  6. Stp1 is important for appropriate regulation of Stk1 function, hemolysin activity, autolysis, and GBS virulence PMID: 22081606
  7. there is a possible Cys modification mechanism for stress regulation of SULT1A1 PMID: 15351727

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
Sulfotransferase 1 family
Tissue Specificity
Liver, kidney, heart and colon.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*