Recombinant Rat Mucosal addressin cell adhesion molecule 1 (Madcam1), partial

In Stock
Code CSB-EP013308RA
Abbreviation Recombinant Rat Madcam1 protein, partial
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
Madcam1Mucosal addressin cell adhesion molecule 1; MAdCAM-1; rMAdCAM-1
Species
Rattus norvegicus (Rat)
Source
E.coli
Expression Region
20-353aa
Target Protein Sequence
QSFQVNPPEPEVAVAMGTSLQINCSMSCDKDIARVHWHGLDTNLGNVQTLPGSRVLSVRGMLSDTGTRVCVGSCGSRSFQHSVKILVYAFPDQLEVTPEFLVPGRDQVVSCTAHNIWPAGPDSLSFALLRGEQSLEGAQALETEQEEEMQETEGTPLFQVTQRWLLPSLGTPALPALYCQVTMQLPKLVLTHRRKIPVLQSQTSPEPPSTTSAKPYILTSSHTTKAVSTGLSSVALPSTPLSSEGPCYPEIHQNPEADWELLCEASCGSGVTVHWTLAPGDLAAYHKREAGAQAWLSVLPLGPIPEGWFQCRMDPGGQVTSLYVTGQVIPNPSS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
52.0kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Rat Mucosal addressin cell adhesion molecule 1 (Madcam1) is expressed in E.coli and comprises the extracellular domain from amino acids 20 to 353. The protein appears to carry an N-terminal 6xHis-SUMO tag for enhanced stability and purification. SDS-PAGE analysis suggests the product achieves a purity exceeding 90%, which may ensure high-quality research applications. This protein is designed for research use only and has not been tested for clinical applications.

Mucosal addressin cell adhesion molecule 1 (Madcam1) plays what seems to be a crucial role in mediating leukocyte trafficking to mucosal tissues. The molecule is primarily involved in immune system processes, where it appears to help bind lymphocytes to endothelial cells lining blood vessels. MAdCAM-1 emerges as a key player in cellular adhesion processes and shows particular significance in studies examining immune response and inflammation.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant rat MAdCAM-1 extracellular domain is expressed in E. coli. This prokaryotic system is fundamentally unsuitable for producing a properly folded and functional eukaryotic cell adhesion molecule. Although only the extracellular domain (20-353aa) is expressed, it retains multiple immunoglobulin-like domains that are critically dependent on the formation of complex, specific disulfide bonds for their correct tertiary structure and stability. E. coli's ability to facilitate proper disulfide bonding for such a multi-domain protein is inefficient and often results in misfolded species. Furthermore, MAdCAM-1 is heavily glycosylated in vivo, a modification that E. coli cannot perform, which can affect the protein's stability and authentic biological interactions. The presence of a large N-terminal 6xHis-SUMO tag may further impair correct folding. The >90% purity indicates low contamination but does not confirm native conformation. Since activity is unverified, the protein can not considered properly folded and biologically active without experimental validation of its structure (e.g., analysis of disulfide bonds, secondary structure) and function (e.g., binding to its receptor, α4β7 integrin).

1. Protein-Protein Interaction Studies Using Pull-Down Assays

The N-terminal 6xHis-SUMO tag enables technical immobilization for pull-down assays. However, if MAdCAM-1 is misfolded (likely due to incorrect disulfide bonds), its receptor-binding sites will not be presented correctly. Any interactions identified with α4β7 integrin or other partners are highly likely to be non-physiological artifacts. This application is not recommended without prior confirmation of native folding and binding activity.

2. Antibody Development and Validation

This application is appropriate. The recombinant protein can serve as an immunogen for generating antibodies that recognize linear epitopes of the MAdCAM-1 sequence, even if the protein is misfolded. The high purity is sufficient for immunization. However, it is crucial to note that resulting antibodies may not recognize conformational, disulfide-dependent, or glycosylation-dependent epitopes present on the native MAdCAM-1 protein in tissues. Validation against glycosylated, native MAdCAM-1 is essential.

3. Biochemical Characterization and Biophysical Analysis

This application is well-suited and should be a priority. Techniques like circular dichroism (to assess secondary structure), analytical size-exclusion chromatography (to check oligomeric state and folding quality), and mass spectrometry (to analyze disulfide bonding) can directly evaluate the conformational state of the recombinant product. These studies are valuable for characterizing the recombinant MAdCAM-1 protein itself, regardless of its bioactivity.

4. Cell Adhesion Assay Development

This application is high-risk and unreliable without functional validation. A misfolded, unglycosylated MAdCAM-1 extracellular domain will not support specific, physiological lymphocyte adhesion via α4β7 integrin. Using this protein to coat surfaces for adhesion assays will likely yield false-negative or misleading results. This application should be avoided unless proper folding and integrin-binding functionality are conclusively demonstrated.

Final Recommendation & Action Plan

Given the high probability of misfolding due to the E. coli expression system's inability to reliably form the complex disulfide bonds required for MAdCAM-1, the following plan is recommended: First, prioritize rigorous biophysical and biochemical characterization using non-reducing SDS-PAGE and mass spectrometry to probe disulfide bond status, circular dichroism for secondary structure, and size-exclusion chromatography for aggregation state. Antibody development can proceed in parallel. Crucially, avoid all functional and interaction studies (Applications 1 and 4) until the protein's structure is validated. If functional studies are required, the protein must be tested in a solid-phase binding assay with a known binding partner (e.g., recombinant α4β7 integrin) to confirm activity. For reliable results in cell adhesion or interaction studies, sourcing MAdCAM-1 from a mammalian expression system capable of proper glycosylation and folding is strongly advised.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both the integrin alpha-4/beta-7 and L-selectin, regulating both the passage and retention of leukocytes.
Gene References into Functions
  1. Immunohistochemical analysis of MAdCAM-1 expression during acute rejection on small bowel grafts in rats PMID: 12034298
  2. Treatment with an antibody to this antigen reduces glomerular and tubulointerstitial scarring in a rat model of crescentic glomerulonephritis PMID: 12368200
  3. Our model of chronic food allergy revealed that lymphocyte migration was increased with MAdCAM-1 upregulation. PMID: 14670821
  4. During small bowel allograft rejection., FTY720 was found to prevent the down-regulation of MAdCAM-1 expression in endothelial venules PMID: 16387148
Subcellular Location
Membrane; Single-pass type I membrane protein.
Tissue Specificity
Detected in Peyer patches and mesenteric lymph nodes but not in spleen.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*