Recombinant Rat Mucosal addressin cell adhesion molecule 1(Madcam1)

Code CSB-CF013308RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. O70540
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence QSFQVNPPEPEVAVAMGTSLQINCSMSCDKDIARVHWHGLDTNLGNVQTLPGSRVLSVRGMLSDTGTRVCVGSCGSRSFQHSVKILVYAFPDQLEVTPEFLVPGRDQVVSCTAHNIWPAGPDSLSFALLRGEQSLEGAQALETEQEEEMQETEGTPLFQVTQRWLLPSLGTPALPALYCQVTMQLPKLVLTHRRKIPVLQSQTSPEPPSTTSAKPYILTSSHTTKAVSTGLSSVALPSTPLSSEGPCYPEIHQNPEADWELLCEASCGSGVTVHWTLAPGDLAAYHKREAGAQAWLSVLPLGPIPEGWFQCRMDPGGQVTSLYVTGQVIPNPSSMVALWIGSLVLGLLALAFLAYCLWKRYRPGPLPDSSSCTLL
Source in vitro E.coli expression system
Gene Names Madcam1
Protein Names Recommended name: Mucosal addressin cell adhesion molecule 1 Short name= MAdCAM-1 Short name= rMAdCAM-1
Expression Region 20-394
Tag Info 10xHis-SUMO-tag
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cell adhesion leukocyte receptor expressed by mucosal venules, helps to direct lymphocyte traffic into mucosal tissues including the Peyer patches and the intestinal lamina propria. It can bind both the integrin alpha-4/beta-7 and L-selectin, regulating both the passage and retention of leukocytes (By similarity).
Subcellular Location Membrane, Single-pass type I membrane protein
Tissue Specificity Detected in Peyer patches and mesenteric lymph nodes but not in spleen.
Database Links

KEGG: rno:54266

STRING: 10116.ENSRNOP00000010939

UniGene: Rn.87175

Related Products

Madcam1 Antibodies

Madcam1 Antibodies for Rattus norvegicus (Rat)

Madcam1 Proteins

Madcam1 Proteins for Rattus norvegicus (Rat)

Madcam1 ELISA Kit

Madcam1 ELISA Kit for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.