Recombinant Saccharomyces cerevisiae 2-deoxyglucose-6-phosphate phosphatase 1 (DOG1)

In Stock
Code CSB-YP336491SVG
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP336491SVG could indicate that this peptide derived from Yeast-expressed Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) DOG1.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP336491SVG could indicate that this peptide derived from Yeast-expressed Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) DOG1.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
DOG1
Uniprot No.
Research Area
others
Alternative Names
DOG1; YHR044C2-deoxyglucose-6-phosphate phosphatase 1; 2-DOG-6-P 1; 2-deoxyglucose-6-phosphatase 1; EC 3.1.3.68
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Source
Yeast
Expression Region
1-246aa
Target Protein Sequence
MAEFSADLCLFDLDGTIVSTTVAAEKAWTKLCYEYGVDPSELFKHSHGARTQEVLRRFFPKLDDTDNKGVLALEKDIAHSYLDTVSLIPGAENLLLSLDVDTETQKKLPERKWAIVTSGSPYLAFSWFETILKNVGKPKVFITGFDVKNGKPDPEGYSRARDLLRQDLQLTGKQDLKYVVFEDAPVGIKAGKAMGAITVGITSSYDKSVLFDAGADYVVCDLTQVSVVKNNENGIVIQVNNPLTRA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
29.1kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The Recombinant Saccharomyces cerevisiae DOG1 is a valuable asset in yeast research and studies involving carbohydrate metabolism. Originating from the Baker's yeast strain (ATCC 204508 / S288c), this protein is known as 2-deoxyglucose-6-phosphate phosphatase 1. This enzyme plays a critical role in the glycolytic pathway, providing researchers with a unique perspective on cellular metabolic processes.

The recombinant DOG1 is expressed in a yeast system and covers the full length of the protein (1-246 amino acids). It includes an N-terminal 6xHis-tag, allowing for easy identification and purification during downstream applications. The product has been meticulously processed to achieve a purity greater than 90%, as confirmed by SDS-PAGE. Choose between liquid or lyophilized powder form as per your research requirements. With the Recombinant Saccharomyces cerevisiae DOG1, you'll gain access to quality, reliability, and precise biological replication in your research.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Active on 2-DOG-6P, also very active on fructose-1P.
Protein Families
HAD-like hydrolase superfamily, DOG/GPP family
Database Links

KEGG: sce:YHR044C

STRING: 4932.YHR044C

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*