Home
Protein
Recombinant Proteins
Recombinant Saccharomyces cerevisiae 2-deoxyglucose-6-phosphate phosphatase 1 (DOG1)

Recombinant Saccharomyces cerevisiae 2-deoxyglucose-6-phosphate phosphatase 1 (DOG1)

^{In Stock}

Code	CSB-YP336491SVG
Abbreviation	Recombinant Saccharomyces cerevisiae DOG1 protein
MSDS	MSDS Datasheet
Size	$436
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP336491SVG could indicate that this peptide derived from Yeast-expressed Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) DOG1. Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP336491SVG could indicate that this peptide derived from Yeast-expressed Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) DOG1.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

DOG1

Uniprot No.

P38774

Research Area

others

Alternative Names

DOG1; YHR044C2-deoxyglucose-6-phosphate phosphatase 1; 2-DOG-6-P 1; 2-deoxyglucose-6-phosphatase 1; EC 3.1.3.68

Species

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Source

Yeast

Expression Region

1-246aa

Target Protein Sequence

MAEFSADLCLFDLDGTIVSTTVAAEKAWTKLCYEYGVDPSELFKHSHGARTQEVLRRFFPKLDDTDNKGVLALEKDIAHSYLDTVSLIPGAENLLLSLDVDTETQKKLPERKWAIVTSGSPYLAFSWFETILKNVGKPKVFITGFDVKNGKPDPEGYSRARDLLRQDLQLTGKQDLKYVVFEDAPVGIKAGKAMGAITVGITSSYDKSVLFDAGADYVVCDLTQVSVVKNNENGIVIQVNNPLTRA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

29.1kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The Recombinant Saccharomyces cerevisiae DOG1 is a valuable asset in yeast research and studies involving carbohydrate metabolism. Originating from the Baker's yeast strain (ATCC 204508 / S288c), this protein is known as 2-deoxyglucose-6-phosphate phosphatase 1. This enzyme plays a critical role in the glycolytic pathway, providing researchers with a unique perspective on cellular metabolic processes.

The recombinant DOG1 is expressed in a yeast system and covers the full length of the protein (1-246 amino acids). It includes an N-terminal 6xHis-tag, allowing for easy identification and purification during downstream applications. The product has been meticulously processed to achieve a purity greater than 90%, as confirmed by SDS-PAGE. Choose between liquid or lyophilized powder form as per your research requirements. With the Recombinant Saccharomyces cerevisiae DOG1, you'll gain access to quality, reliability, and precise biological replication in your research.