Recombinant Saccharomyces cerevisiae GTP-binding nuclear protein GSP1/CNR1 (GSP1)

In Stock
Code CSB-YP333740SVG
Abbreviation Recombinant Saccharomyces cerevisiae GSP1 protein
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
GSP1
Uniprot No.
Research Area
Others
Alternative Names
GSP1; CNR1; CST17; YLR293C; L8003.19; GTP-binding nuclear protein GSP1/CNR1; Chromosome stability protein 17; GTPase Ran homolog; Genetic suppressor of PRP20-1
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Source
Yeast
Expression Region
2-219aa
Target Protein Sequence
SAPAANGEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPALAPPEVQVDEQLMQQYQQEMEQATALPLPDEDDADL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.7kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GSP1 protein production in Yeast cells involves the integration of a DNA fragment encoding the Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GSP1 protein (2-219aa) into a plasmid vector, which is then introduced into Yeast cells. Following screening, positive cells are cultured and induced to synthesize the GSP1 protein. A N-terminal 6xHis tag is attached to the protein. Cell lysis is carried out to harvest the recombinant Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GSP1 protein, which is purified through affinity purification and then analyzed using SDS-PAGE and subsequent staining of the gel with Coomassie Brilliant Blue. The purity of the resulting recombinant Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GSP1 protein reaches over 90%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
GTP-binding protein involved in nucleocytoplasmic transport. Required for the import of protein into the nucleus and also for RNA export. Essential for cell viability. By analogy with Ras, Ran may be activated when GTP is exchanged for bound GDP by RCC1 and inactivated when GTP is hydrolyzed by Ran upon activation by RanGAP1.
Gene References into Functions
  1. Cex1p recruits Rna1p from the cytoplasm to the nuclear pore complex and facilitates Rna1p activation of the GTPase activity of Gsp1p by enabling Rna1p to gain access to Gsp1p-GTP bound to the Los1p-tRNA-Gsp1p-GTP export complex. PMID: 22008473
  2. Study proved that the additional beta-wedge in Prp20p is essential for the interaction between Prp20p and Gsp1p. PMID: 21093592
  3. Thus, the Gtr1p-Gtr2p cycle was suggested to regulate the Ran cycle through Yrb2p. PMID: 16143306
  4. Results suggest that the GSP1 pathway could regulate proper telomeric function in yeast through Sir4p. PMID: 16956377
Subcellular Location
Nucleus.
Protein Families
Small GTPase superfamily, Ran family
Database Links

KEGG: sce:YLR293C

STRING: 4932.YLR293C

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*